BLASTX nr result
ID: Panax25_contig00036403
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036403 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006408556.1 hypothetical protein EUTSA_v10022262mg, partial [... 58 3e-07 JAU78939.1 Sulfite oxidase, partial [Noccaea caerulescens] 55 4e-06 JAU47320.1 Sulfite oxidase, partial [Noccaea caerulescens] 55 4e-06 JAU07469.1 Sulfite oxidase, partial [Noccaea caerulescens] 55 4e-06 JAU72781.1 Sulfite oxidase, partial [Noccaea caerulescens] 55 4e-06 >XP_006408556.1 hypothetical protein EUTSA_v10022262mg, partial [Eutrema salsugineum] ESQ50009.1 hypothetical protein EUTSA_v10022262mg, partial [Eutrema salsugineum] Length = 416 Score = 58.2 bits (139), Expect = 3e-07 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = +2 Query: 302 ERERAEKMPGVRGPSDYSQEPSRHPSLRINAK 397 +R R +KMPG+RGPS+YSQEP+RHPSL++NAK Sbjct: 17 QRRRKKKMPGIRGPSEYSQEPARHPSLKVNAK 48 >JAU78939.1 Sulfite oxidase, partial [Noccaea caerulescens] Length = 410 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = +2 Query: 302 ERERAEKMPGVRGPSDYSQEPSRHPSLRINAK 397 + + +++MPG+RGPS+YSQEP+RHPSL+INAK Sbjct: 11 QNQSSKRMPGIRGPSEYSQEPARHPSLKINAK 42 >JAU47320.1 Sulfite oxidase, partial [Noccaea caerulescens] Length = 410 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = +2 Query: 302 ERERAEKMPGVRGPSDYSQEPSRHPSLRINAK 397 + + +++MPG+RGPS+YSQEP+RHPSL+INAK Sbjct: 11 QNQSSKRMPGIRGPSEYSQEPARHPSLKINAK 42 >JAU07469.1 Sulfite oxidase, partial [Noccaea caerulescens] Length = 413 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = +2 Query: 302 ERERAEKMPGVRGPSDYSQEPSRHPSLRINAK 397 + + +++MPG+RGPS+YSQEP+RHPSL+INAK Sbjct: 14 QNQSSKRMPGIRGPSEYSQEPARHPSLKINAK 45 >JAU72781.1 Sulfite oxidase, partial [Noccaea caerulescens] Length = 416 Score = 54.7 bits (130), Expect = 4e-06 Identities = 21/32 (65%), Positives = 30/32 (93%) Frame = +2 Query: 302 ERERAEKMPGVRGPSDYSQEPSRHPSLRINAK 397 + + +++MPG+RGPS+YSQEP+RHPSL+INAK Sbjct: 17 QNQSSKRMPGIRGPSEYSQEPARHPSLKINAK 48