BLASTX nr result
ID: Panax25_contig00036170
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036170 (519 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016557408.1 PREDICTED: uncharacterized protein LOC107856970 [... 52 5e-06 >XP_016557408.1 PREDICTED: uncharacterized protein LOC107856970 [Capsicum annuum] XP_016557409.1 PREDICTED: uncharacterized protein LOC107856970 [Capsicum annuum] Length = 231 Score = 51.6 bits (122), Expect(2) = 5e-06 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 13/82 (15%) Frame = -2 Query: 464 KHGKEVYVSRLHKQHKIKVGTIIRFIVKR-------------QGATGAKGKWLTEK*EDQ 324 KHGKEV+VSR HK+H+IKVGT +RF VK TG+ +WL K E+ Sbjct: 125 KHGKEVFVSRSHKKHRIKVGTTLRFSVKNFDEEILHICGSLVPSNTGSI-QWLETKAEES 183 Query: 323 RNLGLVDREIRGSKESWAVLAP 258 + + ++ I G+K + +L P Sbjct: 184 QAYSITEKRI-GNKRAAELLEP 204 Score = 25.8 bits (55), Expect(2) = 5e-06 Identities = 12/20 (60%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = -1 Query: 519 GVRLTGKLL-FYPNPDIILE 463 GVR KLL F+P PD++LE Sbjct: 69 GVRFEAKLLLFHPKPDMLLE 88