BLASTX nr result
ID: Panax25_contig00036147
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036147 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017224987.1 PREDICTED: uncharacterized protein LOC108201202 [... 51 1e-06 >XP_017224987.1 PREDICTED: uncharacterized protein LOC108201202 [Daucus carota subsp. sativus] KZM81909.1 hypothetical protein DCAR_029522 [Daucus carota subsp. sativus] Length = 263 Score = 50.8 bits (120), Expect(2) = 1e-06 Identities = 21/30 (70%), Positives = 26/30 (86%) Frame = +1 Query: 289 VIPGEVRAPVKPHLGVASAFCANRSRKLAN 378 VI G+ R P+KPH+G A+AFCANRS+KLAN Sbjct: 226 VISGDTRVPMKPHIGAAAAFCANRSKKLAN 255 Score = 28.9 bits (63), Expect(2) = 1e-06 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 4/32 (12%) Frame = +2 Query: 206 TLNSSPGWKETPQRAAPPVLRTC----APRHL 289 +L+S+P WKETP R P+ C PR+L Sbjct: 172 SLDSTPQWKETPSRMTTPMHFRCKKMNPPRNL 203