BLASTX nr result
ID: Panax25_contig00036090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036090 (702 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ALO23115.1 cytochrome P450 CYP82H28 [Kalopanax septemlobus] 54 2e-08 >ALO23115.1 cytochrome P450 CYP82H28 [Kalopanax septemlobus] Length = 524 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +3 Query: 498 MAFYIKLQDITLGGLLFAVIFLWRIISSHARSSK 599 MAFY +LQDITL GL+FAVI LW+IIS+HARS+K Sbjct: 1 MAFYNQLQDITLLGLVFAVICLWKIISTHARSNK 34 Score = 32.7 bits (73), Expect(2) = 2e-08 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 649 ANKILHQTLGVMADKYGP 702 ANKILH G MADKYGP Sbjct: 57 ANKILHHIFGDMADKYGP 74