BLASTX nr result
ID: Panax25_contig00036028
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036028 (381 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019187945.1 PREDICTED: F-box/LRR-repeat protein 3 isoform X2 ... 74 5e-13 XP_019187944.1 PREDICTED: F-box/LRR-repeat protein 3 isoform X1 ... 74 5e-13 XP_011095229.1 PREDICTED: F-box/LRR-repeat protein 3 [Sesamum in... 72 3e-12 XP_012832233.1 PREDICTED: F-box/LRR-repeat protein 3 [Erythranth... 72 5e-12 XP_006363611.1 PREDICTED: F-box/LRR-repeat protein 3 [Solanum tu... 70 1e-11 XP_004249058.1 PREDICTED: F-box/LRR-repeat protein 3 [Solanum ly... 69 3e-11 XP_019254806.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana ... 69 3e-11 XP_009599188.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana ... 69 3e-11 GAV76944.1 LRR_6 domain-containing protein [Cephalotus follicula... 69 4e-11 XP_016545952.1 PREDICTED: F-box/LRR-repeat protein 3 [Capsicum a... 68 7e-11 XP_017248477.1 PREDICTED: F-box/LRR-repeat protein 3-like [Daucu... 68 8e-11 XP_015089137.1 PREDICTED: F-box/LRR-repeat protein 3 [Solanum pe... 68 8e-11 XP_016482044.1 PREDICTED: F-box/LRR-repeat protein 3-like, parti... 68 1e-10 CDP19947.1 unnamed protein product [Coffea canephora] 68 1e-10 XP_009800839.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana ... 68 1e-10 XP_019106269.1 PREDICTED: F-box/LRR-repeat protein 3 [Beta vulga... 66 5e-10 KNA20076.1 hypothetical protein SOVF_055650 isoform A [Spinacia ... 66 5e-10 XP_015950536.1 PREDICTED: F-box/LRR-repeat protein 3 [Arachis du... 66 5e-10 KMT06633.1 hypothetical protein BVRB_7g158000 isoform B [Beta vu... 66 5e-10 XP_009373101.1 PREDICTED: F-box/LRR-repeat protein 3 [Pyrus x br... 66 5e-10 >XP_019187945.1 PREDICTED: F-box/LRR-repeat protein 3 isoform X2 [Ipomoea nil] Length = 665 Score = 74.3 bits (181), Expect = 5e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 AL +SLQNLSMLQ IKLD CQ TCSGLK IGN C+SL+ELSLSKC Sbjct: 296 ALGESLQNLSMLQSIKLDGCQVTCSGLKAIGNWCVSLKELSLSKC 340 >XP_019187944.1 PREDICTED: F-box/LRR-repeat protein 3 isoform X1 [Ipomoea nil] Length = 666 Score = 74.3 bits (181), Expect = 5e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 AL +SLQNLSMLQ IKLD CQ TCSGLK IGN C+SL+ELSLSKC Sbjct: 296 ALGESLQNLSMLQSIKLDGCQVTCSGLKAIGNWCVSLKELSLSKC 340 >XP_011095229.1 PREDICTED: F-box/LRR-repeat protein 3 [Sesamum indicum] Length = 1144 Score = 72.4 bits (176), Expect = 3e-12 Identities = 36/46 (78%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 ALA SLQ LSMLQ IKLD CQ TCSGLK IGN C+SL ELSLSKC+ Sbjct: 297 ALADSLQKLSMLQSIKLDGCQVTCSGLKAIGNWCVSLTELSLSKCL 342 >XP_012832233.1 PREDICTED: F-box/LRR-repeat protein 3 [Erythranthe guttata] EYU41974.1 hypothetical protein MIMGU_mgv1a002488mg [Erythranthe guttata] Length = 667 Score = 71.6 bits (174), Expect = 5e-12 Identities = 35/46 (76%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 ALA SLQ L MLQ IKLD C+ TCSGLK IGN C+SLRELSLSKC+ Sbjct: 298 ALADSLQKLYMLQSIKLDGCEVTCSGLKAIGNWCVSLRELSLSKCV 343 >XP_006363611.1 PREDICTED: F-box/LRR-repeat protein 3 [Solanum tuberosum] Length = 675 Score = 70.5 bits (171), Expect = 1e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS LQ +KLD CQ TCSGLK IGN C+SL+ELSLSKC+ Sbjct: 306 AVADSLQKLSRLQCVKLDGCQVTCSGLKAIGNWCVSLKELSLSKCV 351 >XP_004249058.1 PREDICTED: F-box/LRR-repeat protein 3 [Solanum lycopersicum] Length = 675 Score = 69.3 bits (168), Expect = 3e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS LQ +KLD CQ TCSGL IGN C+SLRELSLSKC+ Sbjct: 306 AVADSLQKLSRLQCVKLDGCQVTCSGLMAIGNWCVSLRELSLSKCV 351 >XP_019254806.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana attenuata] OIS98126.1 f-boxlrr-repeat protein 3 [Nicotiana attenuata] Length = 678 Score = 69.3 bits (168), Expect = 3e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS L+ +KLD CQ TCSGLK IGN C+SLRELSLSKC+ Sbjct: 307 AVADSLQKLSRLRSVKLDGCQVTCSGLKAIGNWCVSLRELSLSKCL 352 >XP_009599188.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana tomentosiformis] XP_016464071.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana tabacum] Length = 678 Score = 69.3 bits (168), Expect = 3e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS L+ +KLD CQ TCSGLK IGN C+SLRELSLSKC+ Sbjct: 307 AVADSLQKLSRLRSVKLDGCQVTCSGLKAIGNWCVSLRELSLSKCL 352 >GAV76944.1 LRR_6 domain-containing protein [Cephalotus follicularis] Length = 668 Score = 68.9 bits (167), Expect = 4e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 ALA SL+NLSMLQ IKLD C TC GLK IGN C+SL+E+SLSKC Sbjct: 298 ALADSLKNLSMLQSIKLDGCIITCGGLKAIGNCCVSLKEISLSKC 342 >XP_016545952.1 PREDICTED: F-box/LRR-repeat protein 3 [Capsicum annuum] Length = 665 Score = 68.2 bits (165), Expect = 7e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS LQ +KLD CQ TCSGL+ IGN C+SL+ELSLSKC+ Sbjct: 296 AVADSLQKLSRLQSVKLDGCQVTCSGLQAIGNWCVSLKELSLSKCL 341 >XP_017248477.1 PREDICTED: F-box/LRR-repeat protein 3-like [Daucus carota subsp. sativus] KZM97283.1 hypothetical protein DCAR_015355 [Daucus carota subsp. sativus] Length = 667 Score = 68.2 bits (165), Expect = 8e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 ALA +LQ S+LQ IKLD CQ TCSGLK IGN C SLRE+SLSKC+ Sbjct: 298 ALANTLQKCSLLQSIKLDGCQVTCSGLKAIGNWCASLREVSLSKCL 343 >XP_015089137.1 PREDICTED: F-box/LRR-repeat protein 3 [Solanum pennellii] Length = 675 Score = 68.2 bits (165), Expect = 8e-11 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS LQ +KLD CQ TCSGL IGN C+SL+ELSLSKC+ Sbjct: 306 AVADSLQKLSRLQCVKLDGCQVTCSGLMAIGNWCVSLKELSLSKCV 351 >XP_016482044.1 PREDICTED: F-box/LRR-repeat protein 3-like, partial [Nicotiana tabacum] Length = 533 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS L+ +KLD CQ TCSGL+ IGN C+SLRELSLSKC+ Sbjct: 307 AVADSLQKLSRLRSVKLDGCQVTCSGLQAIGNWCVSLRELSLSKCL 352 >CDP19947.1 unnamed protein product [Coffea canephora] Length = 666 Score = 67.8 bits (164), Expect = 1e-10 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 ALA SLQ LSMLQ IKLD CQ +CSGLK IGN +SLRELSLSKC Sbjct: 296 ALADSLQKLSMLQSIKLDGCQVSCSGLKAIGNWRVSLRELSLSKC 340 >XP_009800839.1 PREDICTED: F-box/LRR-repeat protein 3 [Nicotiana sylvestris] Length = 678 Score = 67.8 bits (164), Expect = 1e-10 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 A+A SLQ LS L+ +KLD CQ TCSGL+ IGN C+SLRELSLSKC+ Sbjct: 307 AVADSLQKLSRLRSVKLDGCQVTCSGLQAIGNWCVSLRELSLSKCL 352 >XP_019106269.1 PREDICTED: F-box/LRR-repeat protein 3 [Beta vulgaris subsp. vulgaris] KMT06632.1 hypothetical protein BVRB_7g158000 isoform A [Beta vulgaris subsp. vulgaris] Length = 669 Score = 65.9 bits (159), Expect = 5e-10 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 4 LAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 LA+SLQ LS LQ IKLD C TCSGL+ IGN C SLRELSLSKC Sbjct: 297 LARSLQRLSKLQSIKLDGCVVTCSGLQAIGNYCASLRELSLSKC 340 >KNA20076.1 hypothetical protein SOVF_055650 isoform A [Spinacia oleracea] Length = 677 Score = 65.9 bits (159), Expect = 5e-10 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 4 LAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 LA+SLQ LS LQ IKLD C TCSGL+ IGN C SLRELSLSKC Sbjct: 305 LARSLQRLSKLQSIKLDGCLVTCSGLQAIGNYCASLRELSLSKC 348 >XP_015950536.1 PREDICTED: F-box/LRR-repeat protein 3 [Arachis duranensis] XP_016184032.1 PREDICTED: F-box/LRR-repeat protein 3 [Arachis ipaensis] Length = 678 Score = 65.9 bits (159), Expect = 5e-10 Identities = 33/46 (71%), Positives = 36/46 (78%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 ALA L LSMLQ I LD C TC+GL+ IGNLCISLRELSLSKC+ Sbjct: 304 ALADGLSKLSMLQSIVLDGCLVTCAGLRAIGNLCISLRELSLSKCM 349 >KMT06633.1 hypothetical protein BVRB_7g158000 isoform B [Beta vulgaris subsp. vulgaris] Length = 681 Score = 65.9 bits (159), Expect = 5e-10 Identities = 33/44 (75%), Positives = 35/44 (79%) Frame = +1 Query: 4 LAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKC 135 LA+SLQ LS LQ IKLD C TCSGL+ IGN C SLRELSLSKC Sbjct: 309 LARSLQRLSKLQSIKLDGCVVTCSGLQAIGNYCASLRELSLSKC 352 >XP_009373101.1 PREDICTED: F-box/LRR-repeat protein 3 [Pyrus x bretschneideri] Length = 681 Score = 65.9 bits (159), Expect = 5e-10 Identities = 32/46 (69%), Positives = 36/46 (78%) Frame = +1 Query: 1 ALAKSLQNLSMLQLIKLDCCQFTCSGLKGIGNLCISLRELSLSKCI 138 ALA SL+ L LQ IKLD C TC+GLK IGN C+SLRELSLSKC+ Sbjct: 311 ALADSLEKLPTLQSIKLDGCLVTCAGLKSIGNWCVSLRELSLSKCV 356