BLASTX nr result
ID: Panax25_contig00036012
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036012 (1406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV76367.1 hypothetical protein CFOL_v3_19842, partial [Cephalot... 60 2e-06 GAU48207.1 hypothetical protein TSUD_304870 [Trifolium subterran... 60 5e-06 >GAV76367.1 hypothetical protein CFOL_v3_19842, partial [Cephalotus follicularis] Length = 276 Score = 60.1 bits (144), Expect = 2e-06 Identities = 31/60 (51%), Positives = 44/60 (73%) Frame = +1 Query: 274 KHVEIHQHFIEERRESGPICIPSMTSSE*AADIFTLIFTKVVNRQVFDQLKSKLGMYDIY 453 K+VEI +HFI+E+ E+G IC P + S+E AD + TK V+R+VF+ L +KLGMYDI+ Sbjct: 220 KNVEIDRHFIKEKIEAGLICTPFIPSTEQTAD----MLTKAVHRRVFEHLCTKLGMYDIH 275 >GAU48207.1 hypothetical protein TSUD_304870 [Trifolium subterraneum] Length = 1001 Score = 60.5 bits (145), Expect = 5e-06 Identities = 31/63 (49%), Positives = 42/63 (66%) Frame = +1 Query: 274 KHVEIHQHFIEERRESGPICIPSMTSSE*AADIFTLIFTKVVNRQVFDQLKSKLGMYDIY 453 KH+EI +HFI+E+ ++G IC+P +TSS+ AD I TK + R F+ L KLGM DIY Sbjct: 943 KHIEIDRHFIKEKLDAGIICLPFVTSSQQTAD----ILTKSLARPTFEHLIDKLGMIDIY 998 Query: 454 TRT 462 T Sbjct: 999 APT 1001