BLASTX nr result
ID: Panax25_contig00035989
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00035989 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM89488.1 hypothetical protein DCAR_023149 [Daucus carota subsp... 56 1e-06 XP_017255394.1 PREDICTED: plant cysteine oxidase 3 isoform X1 [D... 56 1e-06 XP_017255395.1 PREDICTED: plant cysteine oxidase 3 isoform X2 [D... 55 3e-06 >KZM89488.1 hypothetical protein DCAR_023149 [Daucus carota subsp. sativus] Length = 255 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 66 TGMDGEMDAVREQEYAWLAEVETPDDLYIHYGRYIYTGPAIH 191 T +GE+ +E+EYAWLAE+ETP DLY+ GR YTGPAIH Sbjct: 213 TAHNGEVGDSKEEEYAWLAEIETPADLYMRNGR--YTGPAIH 252 >XP_017255394.1 PREDICTED: plant cysteine oxidase 3 isoform X1 [Daucus carota subsp. sativus] Length = 276 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +3 Query: 66 TGMDGEMDAVREQEYAWLAEVETPDDLYIHYGRYIYTGPAIH 191 T +GE+ +E+EYAWLAE+ETP DLY+ GR YTGPAIH Sbjct: 234 TAHNGEVGDSKEEEYAWLAEIETPADLYMRNGR--YTGPAIH 273 >XP_017255395.1 PREDICTED: plant cysteine oxidase 3 isoform X2 [Daucus carota subsp. sativus] Length = 274 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = +3 Query: 75 DGEMDAVREQEYAWLAEVETPDDLYIHYGRYIYTGPAIH 191 +GE+ +E+EYAWLAE+ETP DLY+ GR YTGPAIH Sbjct: 235 NGEVGDSKEEEYAWLAEIETPADLYMRNGR--YTGPAIH 271