BLASTX nr result
ID: Panax25_contig00035767
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00035767 (851 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KUM46207.1 hypothetical protein ABT39_MTgene2013 (mitochondrion)... 65 5e-10 >KUM46207.1 hypothetical protein ABT39_MTgene2013 (mitochondrion) [Picea glauca] Length = 88 Score = 65.1 bits (157), Expect = 5e-10 Identities = 31/36 (86%), Positives = 33/36 (91%), Gaps = 1/36 (2%) Frame = -3 Query: 189 MVSSVEFWKVISYYKKENPVVKIACLSCF-AYPFVK 85 MVSSVEFWKVISYYKKENPVVKIACLSCF +P+ K Sbjct: 1 MVSSVEFWKVISYYKKENPVVKIACLSCFQGFPWQK 36