BLASTX nr result
ID: Panax25_contig00035140
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00035140 (452 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006340527.1 PREDICTED: pentatricopeptide repeat-containing pr... 39 7e-06 >XP_006340527.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Solanum tuberosum] Length = 595 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 16/20 (80%), Positives = 20/20 (100%) Frame = -1 Query: 188 HVLKLGFESYLYVCNALIHM 129 +VLKLG++SYLYVCNALI+M Sbjct: 138 NVLKLGYQSYLYVCNALIYM 157 Score = 38.1 bits (87), Expect(2) = 7e-06 Identities = 20/44 (45%), Positives = 28/44 (63%), Gaps = 7/44 (15%) Frame = -2 Query: 115 LVY*FASCC-------MFDKISDRNLVFWNSLIYYRYRQCNTFH 5 L+Y + SC +FD++S+R+LV WNSLI Y QCN +H Sbjct: 154 LIYMYGSCGDLVGAGKVFDQMSERDLVSWNSLI-CGYSQCNRYH 196