BLASTX nr result
ID: Panax25_contig00035102
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00035102 (578 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019433779.1 PREDICTED: WD-40 repeat-containing protein MSI1-l... 58 2e-06 XP_002526518.1 PREDICTED: WD-40 repeat-containing protein MSI1 [... 58 2e-06 XP_011011899.1 PREDICTED: WD-40 repeat-containing protein MSI1-l... 57 3e-06 XP_002320581.1 hypothetical protein POPTR_0014s17790g [Populus t... 57 3e-06 XP_002302832.1 hypothetical protein POPTR_0002s22430g [Populus t... 57 3e-06 XP_015957412.1 PREDICTED: WD-40 repeat-containing protein MSI1 [... 57 4e-06 GAV90044.1 WD40 domain-containing protein/CAF1C_H4-bd domain-con... 56 5e-06 XP_019464603.1 PREDICTED: WD-40 repeat-containing protein MSI1 [... 56 7e-06 KDO46906.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] 55 8e-06 XP_006441951.1 hypothetical protein CICLE_v10020286mg [Citrus cl... 55 8e-06 KCW76781.1 hypothetical protein EUGRSUZ_D011372, partial [Eucaly... 55 9e-06 XP_019416572.1 PREDICTED: WD-40 repeat-containing protein MSI1-l... 55 1e-05 OAY49497.1 hypothetical protein MANES_05G060600 [Manihot esculenta] 55 1e-05 XP_012072627.1 PREDICTED: WD-40 repeat-containing protein MSI1 [... 55 1e-05 XP_006441953.1 hypothetical protein CICLE_v10020286mg [Citrus cl... 55 1e-05 >XP_019433779.1 PREDICTED: WD-40 repeat-containing protein MSI1-like [Lupinus angustifolius] OIW21758.1 hypothetical protein TanjilG_09180 [Lupinus angustifolius] Length = 423 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH ED R+DVGG G + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYEDDRADVGGFGCANAKV 116 >XP_002526518.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Ricinus communis] EEF35909.1 retinoblastoma-binding protein, putative [Ricinus communis] Length = 424 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD+GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYDDDRSDMGGFGAANGKV 116 >XP_011011899.1 PREDICTED: WD-40 repeat-containing protein MSI1-like [Populus euphratica] Length = 424 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYDDDRSDFGGFGAANGKV 116 >XP_002320581.1 hypothetical protein POPTR_0014s17790g [Populus trichocarpa] XP_011001443.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Populus euphratica] EEE98896.1 hypothetical protein POPTR_0014s17790g [Populus trichocarpa] Length = 424 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYDDDRSDFGGFGAANGKV 116 >XP_002302832.1 hypothetical protein POPTR_0002s22430g [Populus trichocarpa] ABK95832.1 unknown [Populus trichocarpa] EEE82105.1 hypothetical protein POPTR_0002s22430g [Populus trichocarpa] Length = 424 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/42 (61%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYDDDRSDFGGFGAANGKV 116 >XP_015957412.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Arachis duranensis] XP_016190458.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Arachis ipaensis] Length = 423 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D +N SRH +D R D+GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLDEAENDSRHYDDDRPDLGGFGAANGKV 116 >GAV90044.1 WD40 domain-containing protein/CAF1C_H4-bd domain-containing protein [Cephalotus follicularis] Length = 424 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD+GG G + +V Sbjct: 75 NEPNYLMLAQVQLPLDDSENDARHYDDDRSDLGGFGCANGKV 116 >XP_019464603.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Lupinus angustifolius] OIW00749.1 hypothetical protein TanjilG_19189 [Lupinus angustifolius] Length = 423 Score = 55.8 bits (133), Expect = 7e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH ED R+D GG G + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYEDDRTDAGGFGCANGKV 116 >KDO46906.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] Length = 325 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD GG G + +V Sbjct: 75 NEPNYLMLAQVQLPLDDSENDARHYDDDRSDFGGFGCANGKV 116 >XP_006441951.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441952.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441959.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55191.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55192.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55199.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] Length = 325 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD GG G + +V Sbjct: 75 NEPNYLMLAQVQLPLDDSENDARHYDDDRSDFGGFGCANGKV 116 >KCW76781.1 hypothetical protein EUGRSUZ_D011372, partial [Eucalyptus grandis] Length = 224 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/42 (57%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP ++ +N +RH +D R+DVGG G + +V Sbjct: 75 NEPNYLMLAQVQLPLEDAENDARHYDDDRADVGGFGCANGKV 116 >XP_019416572.1 PREDICTED: WD-40 repeat-containing protein MSI1-like [Lupinus angustifolius] OIV97124.1 hypothetical protein TanjilG_04928 [Lupinus angustifolius] Length = 422 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYL+LAQV+LP ++ +NG RH ED R+DVGG G + +V Sbjct: 75 NEPNYLILAQVQLPVEDAENGVRHYEDDRTDVGGFGCINGKV 116 >OAY49497.1 hypothetical protein MANES_05G060600 [Manihot esculenta] Length = 424 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP ++ +N +RH +D RSD GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLEDAENDARHYDDDRSDFGGFGAATGKV 116 >XP_012072627.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Jatropha curcas] KDP37791.1 hypothetical protein JCGZ_06693 [Jatropha curcas] Length = 424 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RS+ GG GA + +V Sbjct: 75 NEPNYLMLAQVQLPLDDAENDARHYDDDRSEFGGFGAANGKV 116 >XP_006441953.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441954.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441955.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441956.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441957.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441958.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006441960.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] XP_006478521.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Citrus sinensis] XP_006478522.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Citrus sinensis] XP_006478523.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Citrus sinensis] XP_015385856.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Citrus sinensis] XP_015385857.1 PREDICTED: WD-40 repeat-containing protein MSI1 [Citrus sinensis] ESR55193.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55194.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55195.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55196.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55197.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55198.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] ESR55200.1 hypothetical protein CICLE_v10020286mg [Citrus clementina] KDO46899.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] KDO46900.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] KDO46901.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] KDO46902.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] KDO46903.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] KDO46904.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] KDO46905.1 hypothetical protein CISIN_1g014437mg [Citrus sinensis] Length = 424 Score = 55.5 bits (132), Expect = 1e-05 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +1 Query: 1 NEPNYLMLAQVKLPSDNFKNGSRHEEDSRSDVGGSGATSPQV 126 NEPNYLMLAQV+LP D+ +N +RH +D RSD GG G + +V Sbjct: 75 NEPNYLMLAQVQLPLDDSENDARHYDDDRSDFGGFGCANGKV 116