BLASTX nr result
ID: Panax25_contig00035077
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00035077 (1146 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006421013.1 hypothetical protein CICLE_v10006377mg [Citrus cl... 86 3e-17 XP_003629607.2 hypothetical protein MTR_8g081570 [Medicago trunc... 54 6e-10 ACU23295.1 unknown [Glycine max] 64 8e-10 XP_003601656.2 rhodanese/cell cycle control phosphatase superfam... 55 5e-07 XP_013461206.1 rhodanese/cell cycle control phosphatase superfam... 55 5e-07 >XP_006421013.1 hypothetical protein CICLE_v10006377mg [Citrus clementina] ESR34253.1 hypothetical protein CICLE_v10006377mg [Citrus clementina] Length = 71 Score = 85.5 bits (210), Expect = 3e-17 Identities = 42/62 (67%), Positives = 45/62 (72%) Frame = -2 Query: 782 YPGGGNGKQRDIAQKPAISKPRTVEKRKCFYYFQVALFQ*RKEPATILLSMHHVLAFISS 603 YPGGGNGKQRDIAQ I K +KRK YF VALFQ R EP T+LLSMHHV FISS Sbjct: 7 YPGGGNGKQRDIAQNAGIQKANIFDKRKSLNYFPVALFQERNEPVTMLLSMHHVPTFISS 66 Query: 602 FH 597 F+ Sbjct: 67 FN 68 >XP_003629607.2 hypothetical protein MTR_8g081570 [Medicago truncatula] AET04083.2 hypothetical protein MTR_8g081570 [Medicago truncatula] Length = 583 Score = 53.9 bits (128), Expect(2) = 6e-10 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +1 Query: 706 FSTVLGLLIAGFCAMSRCFPFPPPGYEKKSR 798 F L I+GFCAMSRCFPFPPPGYEKK+R Sbjct: 11 FVPFLEQCISGFCAMSRCFPFPPPGYEKKTR 41 Score = 39.3 bits (90), Expect(2) = 6e-10 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = +3 Query: 624 MVHGQEYSCWLLPLLEQC 677 MVHGQE+SCW +P LEQC Sbjct: 1 MVHGQEHSCWFVPFLEQC 18 >ACU23295.1 unknown [Glycine max] Length = 60 Score = 64.3 bits (155), Expect = 8e-10 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +3 Query: 624 MVHGQEYSCWLLPLLEQCYLKVIEAFSFLNGPWFAYCGFLCNVSLLSISTTRI*KE 791 MVHGQE+SCW +P LEQ Y K+I+A S L + LCNV+L SISTTRI KE Sbjct: 1 MVHGQEHSCWFVPFLEQGYWKIIQAPSNLEEFYTRRIWILCNVALFSISTTRIWKE 56 >XP_003601656.2 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] AES71907.2 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 1378 Score = 54.7 bits (130), Expect(2) = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 730 IAGFCAMSRCFPFPPPGYEKKSR 798 I+GFCAMSRCFPFPPPGYEKKSR Sbjct: 23 ISGFCAMSRCFPFPPPGYEKKSR 45 Score = 28.5 bits (62), Expect(2) = 5e-07 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 624 MVHGQEYSCWLLPLLEQ 674 MVHGQE SCW LEQ Sbjct: 1 MVHGQENSCWFDLFLEQ 17 >XP_013461206.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] KEH35240.1 rhodanese/cell cycle control phosphatase superfamily protein [Medicago truncatula] Length = 1330 Score = 54.7 bits (130), Expect(2) = 5e-07 Identities = 22/23 (95%), Positives = 23/23 (100%) Frame = +1 Query: 730 IAGFCAMSRCFPFPPPGYEKKSR 798 I+GFCAMSRCFPFPPPGYEKKSR Sbjct: 23 ISGFCAMSRCFPFPPPGYEKKSR 45 Score = 28.5 bits (62), Expect(2) = 5e-07 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = +3 Query: 624 MVHGQEYSCWLLPLLEQ 674 MVHGQE SCW LEQ Sbjct: 1 MVHGQENSCWFDLFLEQ 17