BLASTX nr result
ID: Panax25_contig00035036
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00035036 (380 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN11195.1 hypothetical protein DCAR_003851 [Daucus carota subsp... 90 2e-18 XP_017229567.1 PREDICTED: WPP domain-associated protein isoform ... 90 2e-18 XP_012075616.1 PREDICTED: WPP domain-associated protein-like [Ja... 90 2e-18 XP_002523187.1 PREDICTED: WPP domain-associated protein [Ricinus... 90 2e-18 KVI07765.1 hypothetical protein Ccrd_013869 [Cynara cardunculus ... 89 3e-18 XP_019577352.1 PREDICTED: WPP domain-associated protein-like, pa... 88 7e-18 XP_009587880.1 PREDICTED: WPP domain-associated protein-like [Ni... 88 7e-18 XP_006293684.1 hypothetical protein CARUB_v10022643mg [Capsella ... 88 1e-17 XP_010509714.1 PREDICTED: WPP domain-associated protein-like [Ca... 88 1e-17 XP_019100438.1 PREDICTED: WPP domain-associated protein-like iso... 88 1e-17 XP_019100437.1 PREDICTED: WPP domain-associated protein-like iso... 88 1e-17 OAY47299.1 hypothetical protein MANES_06G068100 [Manihot esculen... 88 1e-17 CDX79574.1 BnaC03g19100D [Brassica napus] 87 2e-17 XP_018462946.1 PREDICTED: WPP domain-associated protein-like [Ra... 87 2e-17 XP_018462945.1 PREDICTED: WPP domain-associated protein-like [Ra... 87 2e-17 XP_013734276.1 PREDICTED: WPP domain-associated protein-like [Br... 87 2e-17 XP_013702165.1 PREDICTED: WPP domain-associated protein-like [Br... 87 2e-17 XP_009132999.1 PREDICTED: WPP domain-associated protein [Brassic... 87 2e-17 CDX84632.1 BnaA03g15980D [Brassica napus] 87 2e-17 XP_012075755.1 PREDICTED: WPP domain-associated protein-like [Ja... 87 2e-17 >KZN11195.1 hypothetical protein DCAR_003851 [Daucus carota subsp. sativus] Length = 804 Score = 89.7 bits (221), Expect = 2e-18 Identities = 44/50 (88%), Positives = 45/50 (90%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKSV 229 GDEVE LL LLEKIYIALDHYSP+L HYPGIIEILK VRRELSGET KSV Sbjct: 755 GDEVEELLGLLEKIYIALDHYSPVLQHYPGIIEILKTVRRELSGETSKSV 804 >XP_017229567.1 PREDICTED: WPP domain-associated protein isoform X1 [Daucus carota subsp. sativus] XP_017229568.1 PREDICTED: WPP domain-associated protein isoform X2 [Daucus carota subsp. sativus] XP_017229570.1 PREDICTED: WPP domain-associated protein isoform X1 [Daucus carota subsp. sativus] Length = 859 Score = 89.7 bits (221), Expect = 2e-18 Identities = 44/50 (88%), Positives = 45/50 (90%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKSV 229 GDEVE LL LLEKIYIALDHYSP+L HYPGIIEILK VRRELSGET KSV Sbjct: 810 GDEVEELLGLLEKIYIALDHYSPVLQHYPGIIEILKTVRRELSGETSKSV 859 >XP_012075616.1 PREDICTED: WPP domain-associated protein-like [Jatropha curcas] Length = 883 Score = 89.7 bits (221), Expect = 2e-18 Identities = 44/50 (88%), Positives = 47/50 (94%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKSV 229 GDEV+TLLSLLEKIYIALDHYSPIL HYPGI+EILKLVRRELSGE+ K V Sbjct: 834 GDEVDTLLSLLEKIYIALDHYSPILKHYPGIMEILKLVRRELSGESVKPV 883 >XP_002523187.1 PREDICTED: WPP domain-associated protein [Ricinus communis] XP_015577267.1 PREDICTED: WPP domain-associated protein [Ricinus communis] EEF39218.1 Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 89.7 bits (221), Expect = 2e-18 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKSV 229 GDEV+TLLSLLEKIYIALDHYSPIL HYPGI+E+LKLVRRELSGE+ K V Sbjct: 854 GDEVDTLLSLLEKIYIALDHYSPILQHYPGIMEVLKLVRRELSGESVKPV 903 >KVI07765.1 hypothetical protein Ccrd_013869 [Cynara cardunculus var. scolymus] Length = 873 Score = 89.4 bits (220), Expect = 3e-18 Identities = 42/49 (85%), Positives = 46/49 (93%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKS 232 GDEVETLL LLEKIYIALDHYSP+L HYPG+IEILKLVRRELSGE+ K+ Sbjct: 824 GDEVETLLGLLEKIYIALDHYSPVLQHYPGVIEILKLVRRELSGESLKA 872 >XP_019577352.1 PREDICTED: WPP domain-associated protein-like, partial [Rhinolophus sinicus] Length = 419 Score = 87.8 bits (216), Expect = 7e-18 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGET 241 GDEVETLL LLEKIYIALDHYSPIL HYPGIIEILKLVRRELSGE+ Sbjct: 368 GDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLVRRELSGES 413 >XP_009587880.1 PREDICTED: WPP domain-associated protein-like [Nicotiana tomentosiformis] Length = 898 Score = 88.2 bits (217), Expect = 7e-18 Identities = 42/53 (79%), Positives = 49/53 (92%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKSV*SS 220 GDEV+TLLSLLEKIYIALDHYSP+L HYPGIIEILK+++REL+GE+ K V SS Sbjct: 844 GDEVDTLLSLLEKIYIALDHYSPVLQHYPGIIEILKVIKRELTGESTKLVKSS 896 >XP_006293684.1 hypothetical protein CARUB_v10022643mg [Capsella rubella] XP_006293685.1 hypothetical protein CARUB_v10022643mg [Capsella rubella] EOA26582.1 hypothetical protein CARUB_v10022643mg [Capsella rubella] EOA26583.1 hypothetical protein CARUB_v10022643mg [Capsella rubella] Length = 829 Score = 87.8 bits (216), Expect = 1e-17 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGET 241 GDEVETLL LLEKIYIALDHYSPIL HYPGIIEILKLVRRELSGE+ Sbjct: 779 GDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLVRRELSGES 824 >XP_010509714.1 PREDICTED: WPP domain-associated protein-like [Camelina sativa] XP_010509715.1 PREDICTED: WPP domain-associated protein-like [Camelina sativa] Length = 834 Score = 87.8 bits (216), Expect = 1e-17 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGET 241 GDEVETLL LLEKIYIALDHYSPIL HYPGIIEILKLVRRELSGE+ Sbjct: 784 GDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLVRRELSGES 829 >XP_019100438.1 PREDICTED: WPP domain-associated protein-like isoform X2 [Camelina sativa] Length = 834 Score = 87.8 bits (216), Expect = 1e-17 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGET 241 GDEVETLL LLEKIYIALDHYSPIL HYPGIIEILKLVRRELSGE+ Sbjct: 784 GDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLVRRELSGES 829 >XP_019100437.1 PREDICTED: WPP domain-associated protein-like isoform X1 [Camelina sativa] XP_019100439.1 PREDICTED: WPP domain-associated protein-like isoform X3 [Camelina sativa] Length = 834 Score = 87.8 bits (216), Expect = 1e-17 Identities = 43/46 (93%), Positives = 44/46 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGET 241 GDEVETLL LLEKIYIALDHYSPIL HYPGIIEILKLVRRELSGE+ Sbjct: 784 GDEVETLLDLLEKIYIALDHYSPILKHYPGIIEILKLVRRELSGES 829 >OAY47299.1 hypothetical protein MANES_06G068100 [Manihot esculenta] OAY47300.1 hypothetical protein MANES_06G068100 [Manihot esculenta] OAY47301.1 hypothetical protein MANES_06G068100 [Manihot esculenta] Length = 877 Score = 87.8 bits (216), Expect = 1e-17 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCKSV 229 GDEV+ LLSLLEKIYIALDHYSPIL HYPGI+EILKLVRRELSGE+ K + Sbjct: 828 GDEVDALLSLLEKIYIALDHYSPILQHYPGIMEILKLVRRELSGESVKPI 877 >CDX79574.1 BnaC03g19100D [Brassica napus] Length = 750 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 699 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 743 >XP_018462946.1 PREDICTED: WPP domain-associated protein-like [Raphanus sativus] Length = 810 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 759 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 803 >XP_018462945.1 PREDICTED: WPP domain-associated protein-like [Raphanus sativus] Length = 810 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 759 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 803 >XP_013734276.1 PREDICTED: WPP domain-associated protein-like [Brassica napus] Length = 815 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 764 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 808 >XP_013702165.1 PREDICTED: WPP domain-associated protein-like [Brassica napus] Length = 816 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 765 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 809 >XP_009132999.1 PREDICTED: WPP domain-associated protein [Brassica rapa] Length = 818 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 767 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 811 >CDX84632.1 BnaA03g15980D [Brassica napus] Length = 818 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/45 (93%), Positives = 43/45 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGE 244 GDEVETLL LLEKIYIALDHYSP+L HYPGIIEILKLVRRELSGE Sbjct: 767 GDEVETLLDLLEKIYIALDHYSPVLKHYPGIIEILKLVRRELSGE 811 >XP_012075755.1 PREDICTED: WPP domain-associated protein-like [Jatropha curcas] Length = 819 Score = 87.0 bits (214), Expect = 2e-17 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -3 Query: 378 GDEVETLLSLLEKIYIALDHYSPILHHYPGIIEILKLVRRELSGETCK 235 GD+V+TLLSLLEKIYIALDHYSPIL HYPGI+EILKLVRRELSGE+ K Sbjct: 770 GDKVDTLLSLLEKIYIALDHYSPILKHYPGIMEILKLVRRELSGESVK 817