BLASTX nr result
ID: Panax25_contig00034939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00034939 (416 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AMM45799.1 WRKY6 transcription factor [Panax ginseng] 72 7e-13 AEQ29018.1 WRKY5 [Panax quinquefolius] 72 7e-13 >AMM45799.1 WRKY6 transcription factor [Panax ginseng] Length = 218 Score = 72.4 bits (176), Expect = 7e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 316 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT 414 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT Sbjct: 1 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT 33 >AEQ29018.1 WRKY5 [Panax quinquefolius] Length = 219 Score = 72.4 bits (176), Expect = 7e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +1 Query: 316 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT 414 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT Sbjct: 1 MEYYNRFVHDQDDSPETASGSPLSGEDTIMADT 33