BLASTX nr result
ID: Panax25_contig00034521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00034521 (1030 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017235227.1 PREDICTED: protein transport protein SEC16A homol... 72 3e-10 XP_009399820.2 PREDICTED: protein transport protein SEC16B homol... 71 8e-10 XP_009399739.1 PREDICTED: protein transport protein SEC16B homol... 71 8e-10 XP_017626139.1 PREDICTED: protein transport protein SEC16B homol... 71 8e-10 XP_016721926.1 PREDICTED: protein transport protein SEC16B homol... 71 8e-10 KHG09949.1 Protein transport Sec16B [Gossypium arboreum] 71 8e-10 XP_019421011.1 PREDICTED: protein transport protein SEC16A homol... 71 8e-10 XP_010053480.1 PREDICTED: protein transport protein SEC16B homol... 71 8e-10 XP_010053479.1 PREDICTED: protein transport protein SEC16B homol... 71 8e-10 XP_017408783.1 PREDICTED: protein transport protein SEC16B homol... 71 1e-09 XP_002304277.2 hypothetical protein POPTR_0003s07480g [Populus t... 71 1e-09 XP_007155661.1 hypothetical protein PHAVU_003G220900g [Phaseolus... 71 1e-09 XP_004508906.1 PREDICTED: protein transport protein SEC16B homol... 71 1e-09 XP_006369025.1 hypothetical protein POPTR_0001s15800g [Populus t... 71 1e-09 XP_003608705.2 RGPR-like protein [Medicago truncatula] AES90902.... 71 1e-09 XP_011031880.1 PREDICTED: protein transport protein SEC16B homol... 71 1e-09 XP_012069984.1 PREDICTED: protein transport protein SEC16B homol... 71 1e-09 OAY56720.1 hypothetical protein MANES_02G039800 [Manihot esculenta] 71 1e-09 XP_008448843.1 PREDICTED: protein transport protein SEC16A homol... 71 1e-09 XP_011650398.1 PREDICTED: protein transport protein SEC16B homol... 71 1e-09 >XP_017235227.1 PREDICTED: protein transport protein SEC16A homolog [Daucus carota subsp. sativus] XP_017235228.1 PREDICTED: protein transport protein SEC16A homolog [Daucus carota subsp. sativus] XP_017235229.1 PREDICTED: protein transport protein SEC16A homolog [Daucus carota subsp. sativus] Length = 1558 Score = 72.4 bits (176), Expect = 3e-10 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTEIYEYSKLLGNSQF+LLPFQPYKLVYAYMLAE Sbjct: 1053 IQRTEIYEYSKLLGNSQFLLLPFQPYKLVYAYMLAE 1088 >XP_009399820.2 PREDICTED: protein transport protein SEC16B homolog isoform X2 [Musa acuminata subsp. malaccensis] Length = 1354 Score = 71.2 bits (173), Expect = 8e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKLVYAYMLAE Sbjct: 895 IQRTELYEYSKVLGNSQFILLPFQPYKLVYAYMLAE 930 >XP_009399739.1 PREDICTED: protein transport protein SEC16B homolog isoform X1 [Musa acuminata subsp. malaccensis] Length = 1358 Score = 71.2 bits (173), Expect = 8e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKLVYAYMLAE Sbjct: 899 IQRTELYEYSKVLGNSQFILLPFQPYKLVYAYMLAE 934 >XP_017626139.1 PREDICTED: protein transport protein SEC16B homolog [Gossypium arboreum] XP_017626140.1 PREDICTED: protein transport protein SEC16B homolog [Gossypium arboreum] Length = 1374 Score = 71.2 bits (173), Expect = 8e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKLVYAYMLAE Sbjct: 884 IQRTELYEYSKVLGNSQFILLPFQPYKLVYAYMLAE 919 >XP_016721926.1 PREDICTED: protein transport protein SEC16B homolog [Gossypium hirsutum] XP_016721927.1 PREDICTED: protein transport protein SEC16B homolog [Gossypium hirsutum] Length = 1374 Score = 71.2 bits (173), Expect = 8e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKLVYAYMLAE Sbjct: 884 IQRTELYEYSKVLGNSQFILLPFQPYKLVYAYMLAE 919 >KHG09949.1 Protein transport Sec16B [Gossypium arboreum] Length = 1374 Score = 71.2 bits (173), Expect = 8e-10 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKLVYAYMLAE Sbjct: 884 IQRTELYEYSKVLGNSQFILLPFQPYKLVYAYMLAE 919 >XP_019421011.1 PREDICTED: protein transport protein SEC16A homolog [Lupinus angustifolius] OIV94614.1 hypothetical protein TanjilG_25838 [Lupinus angustifolius] Length = 1423 Score = 71.2 bits (173), Expect = 8e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 925 IQRTELYEYSKMLGNSQFILLPFQPYKLIYAYMLAE 960 >XP_010053480.1 PREDICTED: protein transport protein SEC16B homolog isoform X2 [Eucalyptus grandis] KCW77788.1 hypothetical protein EUGRSUZ_D02081 [Eucalyptus grandis] Length = 1446 Score = 71.2 bits (173), Expect = 8e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 955 IQRTELYEYSKMLGNSQFILLPFQPYKLIYAYMLAE 990 >XP_010053479.1 PREDICTED: protein transport protein SEC16B homolog isoform X1 [Eucalyptus grandis] KCW77789.1 hypothetical protein EUGRSUZ_D02081 [Eucalyptus grandis] Length = 1459 Score = 71.2 bits (173), Expect = 8e-10 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 955 IQRTELYEYSKMLGNSQFILLPFQPYKLIYAYMLAE 990 >XP_017408783.1 PREDICTED: protein transport protein SEC16B homolog isoform X1 [Vigna angularis] BAT75846.1 hypothetical protein VIGAN_01377200 [Vigna angularis var. angularis] Length = 1354 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 880 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 915 >XP_002304277.2 hypothetical protein POPTR_0003s07480g [Populus trichocarpa] EEE79256.2 hypothetical protein POPTR_0003s07480g [Populus trichocarpa] Length = 1371 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 876 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 911 >XP_007155661.1 hypothetical protein PHAVU_003G220900g [Phaseolus vulgaris] ESW27655.1 hypothetical protein PHAVU_003G220900g [Phaseolus vulgaris] Length = 1379 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 880 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 915 >XP_004508906.1 PREDICTED: protein transport protein SEC16B homolog [Cicer arietinum] XP_012573643.1 PREDICTED: protein transport protein SEC16B homolog [Cicer arietinum] XP_012573644.1 PREDICTED: protein transport protein SEC16B homolog [Cicer arietinum] Length = 1386 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 888 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 923 >XP_006369025.1 hypothetical protein POPTR_0001s15800g [Populus trichocarpa] ERP65594.1 hypothetical protein POPTR_0001s15800g [Populus trichocarpa] Length = 1388 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 870 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 905 >XP_003608705.2 RGPR-like protein [Medicago truncatula] AES90902.2 RGPR-like protein [Medicago truncatula] Length = 1401 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 897 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 932 >XP_011031880.1 PREDICTED: protein transport protein SEC16B homolog [Populus euphratica] Length = 1405 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 899 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 934 >XP_012069984.1 PREDICTED: protein transport protein SEC16B homolog [Jatropha curcas] KDP39874.1 hypothetical protein JCGZ_03405 [Jatropha curcas] Length = 1408 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 904 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 939 >OAY56720.1 hypothetical protein MANES_02G039800 [Manihot esculenta] Length = 1417 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 911 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 946 >XP_008448843.1 PREDICTED: protein transport protein SEC16A homolog [Cucumis melo] Length = 1421 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 906 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 941 >XP_011650398.1 PREDICTED: protein transport protein SEC16B homolog [Cucumis sativus] Length = 1422 Score = 70.9 bits (172), Expect = 1e-09 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +2 Query: 824 VHRTEIYEYSKLLGNSQFILLPFQPYKLVYAYMLAE 931 + RTE+YEYSK+LGNSQFILLPFQPYKL+YAYMLAE Sbjct: 910 IQRTELYEYSKVLGNSQFILLPFQPYKLIYAYMLAE 945