BLASTX nr result
ID: Panax25_contig00034448
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00034448 (688 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013597716.1 PREDICTED: ras-related protein RABD2b-like isofor... 55 1e-05 >XP_013597716.1 PREDICTED: ras-related protein RABD2b-like isoform X1 [Brassica oleracea var. oleracea] Length = 232 Score = 55.5 bits (132), Expect = 1e-05 Identities = 31/58 (53%), Positives = 34/58 (58%) Frame = +1 Query: 502 LQVYRTILMCCFNHLR*NT*CAFTDAALNIHLYSYLDSYISTIGVDLKIRTVEQDGKT 675 L +Y CC C+F L + SYLDSYISTIGVD KIRTVEQDGKT Sbjct: 38 LSLYSVQCSCC---------CSFEVVLLLVQDDSYLDSYISTIGVDFKIRTVEQDGKT 86