BLASTX nr result
ID: Panax25_contig00034447
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00034447 (881 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013597716.1 PREDICTED: ras-related protein RABD2b-like isofor... 64 2e-08 XP_010109134.1 GTP-binding protein YPTM2 [Morus notabilis] EXC21... 62 2e-07 KHF99585.1 Ras-related RIC1 [Gossypium arboreum] 57 2e-07 XP_015902008.1 PREDICTED: GTP-binding protein YPTM2-like isoform... 58 2e-07 KCW71910.1 hypothetical protein EUGRSUZ_E00370 [Eucalyptus grandis] 60 3e-07 ACU18790.1 unknown [Glycine max] 58 3e-07 XP_015962208.1 PREDICTED: ras-related protein RABD2a-like isofor... 59 5e-07 KHN09857.1 Ras-related protein RABD2c [Glycine soja] 61 5e-07 XP_006414216.1 hypothetical protein EUTSA_v10026573mg [Eutrema s... 58 5e-07 ABD65039.1 GTP-binding protein, putative [Brassica oleracea] 59 7e-07 JAU80331.1 GTP-binding protein YPTM2, partial [Noccaea caerulesc... 58 7e-07 OIV94085.1 hypothetical protein TanjilG_05465 [Lupinus angustifo... 59 8e-07 XP_013457602.1 RAB GTPase-like protein A2D [Medicago truncatula]... 59 8e-07 XP_013728491.1 PREDICTED: ras-related protein RABD2c-like, parti... 58 8e-07 EMS66115.1 Ras-related protein RIC1 [Triticum urartu] 60 9e-07 AQK73196.1 ypt homolog4, partial [Zea mays] 58 1e-06 XP_013597717.1 PREDICTED: ras-related protein RABD2b-like isofor... 59 1e-06 EPS57801.1 guanine nucleotide regulatory protein, partial [Genli... 57 1e-06 AQK96055.1 Ras-related protein RABD2c [Zea mays] 56 1e-06 EMS52258.1 GTP-binding protein YPTM2 [Triticum urartu] 58 1e-06 >XP_013597716.1 PREDICTED: ras-related protein RABD2b-like isoform X1 [Brassica oleracea var. oleracea] Length = 232 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 567 WHLIHILIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 + ++ +L+QDDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 51 FEVVLLLVQDDSYLDSYISTIGVDFKIRTVEQDGKT 86 >XP_010109134.1 GTP-binding protein YPTM2 [Morus notabilis] EXC21063.1 GTP-binding protein YPTM2 [Morus notabilis] Length = 243 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +3 Query: 585 LIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 L+QDDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 68 LMQDDSYLDSYISTIGVDFKIRTVEQDGKT 97 >KHF99585.1 Ras-related RIC1 [Gossypium arboreum] Length = 65 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/29 (89%), Positives = 29/29 (100%) Frame = +3 Query: 588 IQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 +QDDSY++SYISTIGVDFKIRTVEQDGKT Sbjct: 1 MQDDSYVESYISTIGVDFKIRTVEQDGKT 29 >XP_015902008.1 PREDICTED: GTP-binding protein YPTM2-like isoform X1 [Ziziphus jujuba] XP_015902009.1 PREDICTED: GTP-binding protein YPTM2-like isoform X2 [Ziziphus jujuba] Length = 81 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 30 DDSYLDSYISTIGVDFKIRTVEQDGKT 56 >KCW71910.1 hypothetical protein EUGRSUZ_E00370 [Eucalyptus grandis] Length = 187 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 576 IHILIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 ++ L QDDSYL+SYISTIGVDFKIRTVEQDGKT Sbjct: 8 LYFLDQDDSYLESYISTIGVDFKIRTVEQDGKT 40 >ACU18790.1 unknown [Glycine max] Length = 101 Score = 57.8 bits (138), Expect = 3e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 30 DDSYLDSYISTIGVDFKIRTVEQDGKT 56 >XP_015962208.1 PREDICTED: ras-related protein RABD2a-like isoform X2 [Arachis duranensis] XP_016194161.1 PREDICTED: ras-related protein RABD2a-like isoform X2 [Arachis ipaensis] Length = 182 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 582 ILIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 I +QDDSY++SYISTIGVDFKIRTVEQDGKT Sbjct: 6 ICLQDDSYIESYISTIGVDFKIRTVEQDGKT 36 >KHN09857.1 Ras-related protein RABD2c [Glycine soja] Length = 298 Score = 60.8 bits (146), Expect = 5e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 573 LIHILIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 + H + DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 11 MCHAAVGDDSYLDSYISTIGVDFKIRTVEQDGKT 44 Score = 58.2 bits (139), Expect = 4e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 591 QDDSYLDSYISTIGVDFKIRTVEQDGKT 674 +DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 125 KDDSYLDSYISTIGVDFKIRTVEQDGKT 152 >XP_006414216.1 hypothetical protein EUTSA_v10026573mg [Eutrema salsugineum] ESQ55669.1 hypothetical protein EUTSA_v10026573mg [Eutrema salsugineum] Length = 123 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 30 DDSYLDSYISTIGVDFKIRTVEQDGKT 56 >ABD65039.1 GTP-binding protein, putative [Brassica oleracea] Length = 189 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 585 LIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 +I DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 14 VILDDSYLDSYISTIGVDFKIRTVEQDGKT 43 >JAU80331.1 GTP-binding protein YPTM2, partial [Noccaea caerulescens] Length = 138 Score = 57.8 bits (138), Expect = 7e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 86 DDSYLDSYISTIGVDFKIRTVEQDGKT 112 >OIV94085.1 hypothetical protein TanjilG_05465 [Lupinus angustifolius] Length = 178 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 591 QDDSYLDSYISTIGVDFKIRTVEQDGKT 674 +DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 5 EDDSYLDSYISTIGVDFKIRTVEQDGKT 32 >XP_013457602.1 RAB GTPase-like protein A2D [Medicago truncatula] KEH31633.1 RAB GTPase-like protein A2D [Medicago truncatula] Length = 178 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 591 QDDSYLDSYISTIGVDFKIRTVEQDGKT 674 +DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 5 EDDSYLDSYISTIGVDFKIRTVEQDGKT 32 >XP_013728491.1 PREDICTED: ras-related protein RABD2c-like, partial [Brassica napus] Length = 144 Score = 57.8 bits (138), Expect = 8e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 30 DDSYLDSYISTIGVDFKIRTVEQDGKT 56 >EMS66115.1 Ras-related protein RIC1 [Triticum urartu] Length = 317 Score = 60.1 bits (144), Expect = 9e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 552 CFHWRWHLIHILIQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 C R+ H + +DDSYL+SYISTIGVDFKIRTVEQDGKT Sbjct: 23 CLLLRFAGCHAMNKDDSYLESYISTIGVDFKIRTVEQDGKT 63 >AQK73196.1 ypt homolog4, partial [Zea mays] Length = 153 Score = 57.8 bits (138), Expect = 1e-06 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 82 DDSYLDSYISTIGVDFKIRTVEQDGKT 108 >XP_013597717.1 PREDICTED: ras-related protein RABD2b-like isoform X2 [Brassica oleracea var. oleracea] Length = 202 Score = 58.5 bits (140), Expect = 1e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 588 IQDDSYLDSYISTIGVDFKIRTVEQDGKT 674 + DDSYLDSYISTIGVDFKIRTVEQDGKT Sbjct: 28 VADDSYLDSYISTIGVDFKIRTVEQDGKT 56 >EPS57801.1 guanine nucleotide regulatory protein, partial [Genlisea aurea] Length = 132 Score = 57.0 bits (136), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSY+DSYISTIGVDFKIRTVEQDGKT Sbjct: 25 DDSYIDSYISTIGVDFKIRTVEQDGKT 51 >AQK96055.1 Ras-related protein RABD2c [Zea mays] Length = 104 Score = 56.2 bits (134), Expect = 1e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 594 DDSYLDSYISTIGVDFKIRTVEQDGKT 674 DDSYL+SYISTIGVDFKIRTVEQDGKT Sbjct: 30 DDSYLESYISTIGVDFKIRTVEQDGKT 56 >EMS52258.1 GTP-binding protein YPTM2 [Triticum urartu] Length = 189 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +3 Query: 591 QDDSYLDSYISTIGVDFKIRTVEQDGKT 674 QDDSYL+SYISTIGVDFKIRTVEQDGKT Sbjct: 15 QDDSYLESYISTIGVDFKIRTVEQDGKT 42