BLASTX nr result
ID: Panax25_contig00034292
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00034292 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM99765.1 hypothetical protein DCAR_012873 [Daucus carota subsp... 57 5e-07 >KZM99765.1 hypothetical protein DCAR_012873 [Daucus carota subsp. sativus] Length = 601 Score = 57.0 bits (136), Expect = 5e-07 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +1 Query: 1 VSQQSTVIPGRDVLHKEYKELEAKFSNGSAIQISNFGWLENQSLI 135 VS+QS+VIPGRDVL + +KELE KFS+GSAI+IS+ L NQ L+ Sbjct: 498 VSKQSSVIPGRDVLQQYHKELEEKFSDGSAIEISDLVCLANQILL 542