BLASTX nr result
ID: Panax25_contig00033470
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00033470 (530 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_072539068.1 hypothetical protein [Enterococcus faecium] 52 4e-06 WP_075881626.1 hypothetical protein [Halomonas sp. Marseille-P2426] 52 9e-06 >WP_072539068.1 hypothetical protein [Enterococcus faecium] Length = 65 Score = 52.0 bits (123), Expect = 4e-06 Identities = 23/29 (79%), Positives = 23/29 (79%) Frame = +1 Query: 436 SHTEPEPKLQRSEERRVGKECRSRWSPYH 522 SH E L RSEERRVGKECRSRWSPYH Sbjct: 37 SHLRNEYDLDRSEERRVGKECRSRWSPYH 65 >WP_075881626.1 hypothetical protein [Halomonas sp. Marseille-P2426] Length = 80 Score = 51.6 bits (122), Expect = 9e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = -3 Query: 528 FLMIRRPPRSTLFPYTTLFRSLKLRFRFSMG 436 FLMIRRPPRSTLFPYTTLFRS+ +R R G Sbjct: 26 FLMIRRPPRSTLFPYTTLFRSMCIRDRLGPG 56