BLASTX nr result
ID: Panax25_contig00033393
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00033393 (669 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN10732.1 hypothetical protein DCAR_003388 [Daucus carota subsp... 43 3e-07 >KZN10732.1 hypothetical protein DCAR_003388 [Daucus carota subsp. sativus] Length = 165 Score = 42.7 bits (99), Expect(2) = 3e-07 Identities = 28/77 (36%), Positives = 37/77 (48%) Frame = -1 Query: 339 EFASATPGSTPDALNNNTLADVLFITGQLLPQTTPLETCHSQVLDHANSIELSSPPCSNK 160 EF S S +A NN +LADVLF G L+PQ +T NS S P S+K Sbjct: 55 EFNSVIDKSVENASNNKSLADVLFSNGHLVPQANQSQT---------NSKNSSRPSRSSK 105 Query: 159 RKSSGNDKDANESSGKS 109 + GN E++ K+ Sbjct: 106 KIGGGNKVGETETAKKT 122 Score = 39.7 bits (91), Expect(2) = 3e-07 Identities = 23/48 (47%), Positives = 29/48 (60%) Frame = -2 Query: 536 MTKNMSPDVAVEHVSADLLSLAGLLCIEDENCKPWLVRVSNPPLRNNA 393 M K S DVA E VS D LS AGL+CIE+ + + V S P +N+A Sbjct: 1 MPKTKSKDVAAETVSTDSLSFAGLICIEERSYESPKVHAS--PAKNSA 46