BLASTX nr result
ID: Panax25_contig00033327
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00033327 (1192 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI08599.1 Ribosomal protein S6e [Cynara cardunculus var. scolymus] 85 8e-31 XP_010273001.1 PREDICTED: 40S ribosomal protein S6 [Nelumbo nuci... 79 1e-22 XP_006854035.1 PREDICTED: 40S ribosomal protein S6 [Amborella tr... 79 2e-22 XP_009380211.1 PREDICTED: 40S ribosomal protein S6 [Musa acumina... 77 2e-22 XP_009390279.1 PREDICTED: 40S ribosomal protein S6 [Musa acumina... 77 2e-22 XP_002273865.1 PREDICTED: 40S ribosomal protein S6 isoform X1 [V... 77 2e-22 XP_006853279.1 PREDICTED: 40S ribosomal protein S6 [Amborella tr... 78 4e-22 OAY72619.1 40S ribosomal protein S6 [Ananas comosus] 76 5e-22 XP_020089999.1 40S ribosomal protein S6-like isoform X1 [Ananas ... 76 5e-22 XP_009390908.1 PREDICTED: 40S ribosomal protein S6-like [Musa ac... 77 5e-22 XP_010939689.1 PREDICTED: 40S ribosomal protein S6 [Elaeis guine... 77 5e-22 XP_020090000.1 40S ribosomal protein S6-like isoform X2 [Ananas ... 76 5e-22 XP_008790913.1 PREDICTED: 40S ribosomal protein S6 [Phoenix dact... 76 5e-22 XP_008782166.1 PREDICTED: 40S ribosomal protein S6-like isoform ... 76 5e-22 XP_002271632.1 PREDICTED: 40S ribosomal protein S6 [Vitis vinife... 76 5e-22 XP_002285752.1 PREDICTED: 40S ribosomal protein S6 [Vitis vinife... 76 5e-22 XP_008782167.1 PREDICTED: 40S ribosomal protein S6-like isoform ... 76 5e-22 XP_008778719.1 PREDICTED: 40S ribosomal protein S6-like [Phoenix... 76 7e-22 XP_002525831.2 PREDICTED: 40S ribosomal protein S6 [Ricinus comm... 80 9e-22 EEF36525.1 40S ribosomal protein S6, putative [Ricinus communis] 80 9e-22 >KVI08599.1 Ribosomal protein S6e [Cynara cardunculus var. scolymus] Length = 214 Score = 84.7 bits (208), Expect(2) = 8e-31 Identities = 62/143 (43%), Positives = 81/143 (56%), Gaps = 25/143 (17%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIM-GGAERGNLMIYEVVQHMTMEFYITASS--- 419 RAFFDKRISQ+VSGD+LGEEFKGYVFKIM G ++G M V+ + + + Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDKQGFPMKQGVLTPGRVRLLLVRGTPCF 84 Query: 418 -------GSK--------IIMLE*SPLDY----STSSDC--LNIQQSSCF*RKKCSKAPK 302 G + I+ + S L+ SD L + K+CSKAPK Sbjct: 85 RGYGRRNGERRRKSVRGCIVSQDLSVLNLVIVKKGESDLPGLTDVEKPRMRGKECSKAPK 144 Query: 301 IQRLITPLTLQRKRARISERKSK 233 IQRL+TPLTLQRKRARI+++K + Sbjct: 145 IQRLVTPLTLQRKRARIADKKKR 167 Score = 79.0 bits (193), Expect(2) = 8e-31 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAADYQKLLASRLKEQRE+RSESLAKKRS+LSAA KP Sbjct: 166 KRIAKAKSEAADYQKLLASRLKEQREKRSESLAKKRSRLSAASKP 210 >XP_010273001.1 PREDICTED: 40S ribosomal protein S6 [Nelumbo nucifera] Length = 249 Score = 78.6 bits (192), Expect(2) = 1e-22 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS+LSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 1e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_006854035.1 PREDICTED: 40S ribosomal protein S6 [Amborella trichopoda] ERN15502.1 hypothetical protein AMTR_s00048p00058600 [Amborella trichopoda] Length = 249 Score = 78.6 bits (192), Expect(2) = 2e-22 Identities = 41/45 (91%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLASRLKEQRERRSESLAKKRS+LSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLASRLKEQRERRSESLAKKRSRLSAASKP 245 Score = 56.6 bits (135), Expect(2) = 2e-22 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRAR++E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARMAEKKKR 202 Score = 63.9 bits (154), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAF+DKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_009380211.1 PREDICTED: 40S ribosomal protein S6 [Musa acuminata subsp. malaccensis] Length = 249 Score = 77.4 bits (189), Expect(2) = 2e-22 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 2e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_009390279.1 PREDICTED: 40S ribosomal protein S6 [Musa acuminata subsp. malaccensis] Length = 249 Score = 77.4 bits (189), Expect(2) = 2e-22 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 2e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_002273865.1 PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] XP_010652675.1 PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] XP_010652676.1 PREDICTED: 40S ribosomal protein S6 isoform X1 [Vitis vinifera] XP_010652677.1 PREDICTED: 40S ribosomal protein S6 isoform X2 [Vitis vinifera] CBI33138.3 unnamed protein product, partial [Vitis vinifera] Length = 249 Score = 77.4 bits (189), Expect(2) = 2e-22 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA+RLKEQRERRSESLAKKRS+LSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 2e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_006853279.1 PREDICTED: 40S ribosomal protein S6 [Amborella trichopoda] ERN14746.1 hypothetical protein AMTR_s00038p00238890 [Amborella trichopoda] Length = 249 Score = 77.8 bits (190), Expect(2) = 4e-22 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLASR+KEQRERRSESLAKKRS+LSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLASRIKEQRERRSESLAKKRSRLSAASKP 245 Score = 56.6 bits (135), Expect(2) = 4e-22 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRAR++E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARMAEKKKR 202 Score = 63.9 bits (154), Expect = 6e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAF+DKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFYDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >OAY72619.1 40S ribosomal protein S6 [Ananas comosus] Length = 312 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 264 KRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 308 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 235 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 265 Score = 65.1 bits (157), Expect = 4e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 88 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 121 >XP_020089999.1 40S ribosomal protein S6-like isoform X1 [Ananas comosus] Length = 290 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 242 KRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 286 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 213 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 243 Score = 65.1 bits (157), Expect = 3e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 66 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 99 >XP_009390908.1 PREDICTED: 40S ribosomal protein S6-like [Musa acuminata subsp. malaccensis] Length = 249 Score = 77.4 bits (189), Expect(2) = 5e-22 Identities = 40/45 (88%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 56.6 bits (135), Expect(2) = 5e-22 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+++K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIADKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_010939689.1 PREDICTED: 40S ribosomal protein S6 [Elaeis guineensis] Length = 249 Score = 76.6 bits (187), Expect(2) = 5e-22 Identities = 40/45 (88%), Positives = 43/45 (95%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 RRIAKAKSEAAEYQKLLAMRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.4 bits (137), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKRR 202 Score = 63.5 bits (153), Expect = 8e-08 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEF+GYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFQGYVFKIMGGCDK 58 >XP_020090000.1 40S ribosomal protein S6-like isoform X2 [Ananas comosus] Length = 249 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 KRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_008790913.1 PREDICTED: 40S ribosomal protein S6 [Phoenix dactylifera] Length = 249 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 KRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_008782166.1 PREDICTED: 40S ribosomal protein S6-like isoform X1 [Phoenix dactylifera] Length = 249 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 KRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEF GYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDK 58 >XP_002271632.1 PREDICTED: 40S ribosomal protein S6 [Vitis vinifera] CBI34076.3 unnamed protein product, partial [Vitis vinifera] Length = 249 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA+RLKEQRERRSESLAK+RS+LSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSRLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 62.8 bits (151), Expect = 1e-07 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAF+DKRISQ+V+GD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFYDKRISQEVNGDALGEEFKGYVFKIMGGCDK 58 >XP_002285752.1 PREDICTED: 40S ribosomal protein S6 [Vitis vinifera] CBI19191.3 unnamed protein product, partial [Vitis vinifera] Length = 249 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAKSEAA+YQKLLA+RLKEQRERRSESLAK+RS+LSAA KP Sbjct: 201 KRIAKAKSEAAEYQKLLATRLKEQRERRSESLAKRRSRLSAASKP 245 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 202 Score = 63.2 bits (152), Expect = 1e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEF GYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFNGYVFKIMGGCDK 58 >XP_008782167.1 PREDICTED: 40S ribosomal protein S6-like isoform X2 [Phoenix dactylifera] Length = 197 Score = 76.3 bits (186), Expect(2) = 5e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 149 KRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 193 Score = 57.8 bits (138), Expect(2) = 5e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 120 KKCSKAPKIQRLVTPLTLQRKRARIAEKKKR 150 >XP_008778719.1 PREDICTED: 40S ribosomal protein S6-like [Phoenix dactylifera] Length = 249 Score = 76.3 bits (186), Expect(2) = 7e-22 Identities = 39/45 (86%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 +RIAKAK+EAA+YQKLLA+RLKEQRERRSESLAK+RSKLSAA KP Sbjct: 201 RRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKRRSKLSAASKP 245 Score = 57.4 bits (137), Expect(2) = 7e-22 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KKCSKAPKIQRL+TPLTLQRKRARI+E+K + Sbjct: 172 KKCSKAPKIQRLVTPLTLQRKRARIAEKKRR 202 Score = 65.1 bits (157), Expect = 2e-08 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGEEFKGYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEEFKGYVFKIMGGCDK 58 >XP_002525831.2 PREDICTED: 40S ribosomal protein S6 [Ricinus communis] Length = 249 Score = 80.5 bits (197), Expect(2) = 9e-22 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 QRIAKAKSEAADYQKLLA+RLKEQRERRSESLAKKRS+LSAA KP Sbjct: 201 QRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKP 245 Score = 52.8 bits (125), Expect(2) = 9e-22 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KK SKAPKIQRL+TPLTLQRKRARI+++K + Sbjct: 172 KKVSKAPKIQRLVTPLTLQRKRARIAQKKQR 202 Score = 57.8 bits (138), Expect = 7e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -1 Query: 586 RAFFDKRISQDVSGDSLGEEFKGYVFKIMGGAER 485 RAFFDKRISQ+VSGD+LGE GYVFKIMGG ++ Sbjct: 25 RAFFDKRISQEVSGDALGEXXXGYVFKIMGGCDK 58 >EEF36525.1 40S ribosomal protein S6, putative [Ricinus communis] Length = 197 Score = 80.5 bits (197), Expect(2) = 9e-22 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -3 Query: 236 QRIAKAKSEAADYQKLLASRLKEQRERRSESLAKKRSKLSAAFKP 102 QRIAKAKSEAADYQKLLA+RLKEQRERRSESLAKKRS+LSAA KP Sbjct: 149 QRIAKAKSEAADYQKLLATRLKEQRERRSESLAKKRSRLSAASKP 193 Score = 52.8 bits (125), Expect(2) = 9e-22 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 325 KKCSKAPKIQRLITPLTLQRKRARISERKSK 233 KK SKAPKIQRL+TPLTLQRKRARI+++K + Sbjct: 120 KKVSKAPKIQRLVTPLTLQRKRARIAQKKQR 150