BLASTX nr result
ID: Panax25_contig00033288
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00033288 (361 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009602545.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 2e-06 >XP_009602545.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic isoform X1 [Nicotiana tomentosiformis] XP_016469097.1 PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like isoform X1 [Nicotiana tabacum] Length = 856 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = -3 Query: 122 TTCTSFITFCGYARYFPNAHILFCNIILEFGKKGDLVSAL 3 T +S +T C YA FP+ I+FC +ILEFGKKGDL SAL Sbjct: 203 TAVSSIMTLCRYAHIFPHVDIMFCTVILEFGKKGDLASAL 242