BLASTX nr result
ID: Panax25_contig00033182
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00033182 (1406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012835840.1 PREDICTED: uncharacterized protein LOC105956540 [... 56 4e-06 XP_012839459.1 PREDICTED: uncharacterized protein LOC105959844 [... 56 9e-06 >XP_012835840.1 PREDICTED: uncharacterized protein LOC105956540 [Erythranthe guttata] XP_012850084.1 PREDICTED: uncharacterized protein LOC105969854 [Erythranthe guttata] Length = 111 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 97 CQFFAWYDPPMCDRSRQIISGLLRKINGMEQE 2 C+++ W DPPMCDRSR IISGLLRKIN E E Sbjct: 26 CKYYVWIDPPMCDRSRNIISGLLRKINKYEDE 57 >XP_012839459.1 PREDICTED: uncharacterized protein LOC105959844 [Erythranthe guttata] Length = 166 Score = 56.2 bits (134), Expect = 9e-06 Identities = 23/32 (71%), Positives = 27/32 (84%) Frame = -2 Query: 97 CQFFAWYDPPMCDRSRQIISGLLRKINGMEQE 2 C +FAW DPPMC+RSRQII GLLR+IN E+E Sbjct: 102 CNYFAWVDPPMCERSRQIIPGLLRRINNNEKE 133