BLASTX nr result
ID: Panax25_contig00033160
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00033160 (457 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM99063.1 hypothetical protein DCAR_013575 [Daucus carota subsp... 55 2e-07 KZM92165.1 hypothetical protein DCAR_020470 [Daucus carota subsp... 54 3e-07 KMT15406.1 hypothetical protein BVRB_3g061100 [Beta vulgaris sub... 52 2e-06 KNA11392.1 hypothetical protein SOVF_135650 [Spinacia oleracea] 51 5e-06 >KZM99063.1 hypothetical protein DCAR_013575 [Daucus carota subsp. sativus] Length = 60 Score = 55.1 bits (131), Expect = 2e-07 Identities = 27/49 (55%), Positives = 33/49 (67%) Frame = -1 Query: 334 LLAFIVAAVSGQGLAPSPSPQAGAGFSLPLSTAVVGTXXXXXXXXXLRH 188 +LA +VAA S Q +AP+PSP G+GFSLP+STAVVGT RH Sbjct: 12 VLAVVVAAASAQEMAPAPSPDMGSGFSLPVSTAVVGTSLVFSLVALFRH 60 >KZM92165.1 hypothetical protein DCAR_020470 [Daucus carota subsp. sativus] Length = 61 Score = 54.3 bits (129), Expect = 3e-07 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -1 Query: 364 QLSFLVLKAFLLAFIVA-AVSGQGLAPSPSPQAGAGFSLPLSTAVVGT 224 Q+S V+KA L+ + A AVSGQ AP+PSP GAGFSLP+STAVVGT Sbjct: 3 QVSSFVVKAILVVVLAAVAVSGQE-APAPSPDVGAGFSLPVSTAVVGT 49 >KMT15406.1 hypothetical protein BVRB_3g061100 [Beta vulgaris subsp. vulgaris] Length = 65 Score = 52.4 bits (124), Expect = 2e-06 Identities = 25/43 (58%), Positives = 32/43 (74%) Frame = -1 Query: 358 SFLVLKAFLLAFIVAAVSGQGLAPSPSPQAGAGFSLPLSTAVV 230 SF+ + +VAAV+ Q +APSP+P AGAGFSLP+STAVV Sbjct: 9 SFITFFVAAILAMVAAVNAQAMAPSPAPDAGAGFSLPISTAVV 51 >KNA11392.1 hypothetical protein SOVF_135650 [Spinacia oleracea] Length = 65 Score = 51.2 bits (121), Expect = 5e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -1 Query: 358 SFLVLKAFLLAFIVAAVSGQGLAPSPSPQAGAGFSLPLSTAVV 230 SF A +LA IVA+V+ Q +APSP+P AGAGFSLP+STAVV Sbjct: 9 SFTFFVAAILA-IVASVNAQEMAPSPAPAAGAGFSLPVSTAVV 50