BLASTX nr result
ID: Panax25_contig00032984
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032984 (711 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010269452.1 PREDICTED: nuclear transcription factor Y subunit... 57 1e-06 CBI32238.3 unnamed protein product, partial [Vitis vinifera] 55 3e-06 CDP03522.1 unnamed protein product [Coffea canephora] 56 4e-06 KYP71486.1 Nuclear transcription factor Y subunit B-5 [Cajanus c... 55 5e-06 CAN82321.1 hypothetical protein VITISV_021316 [Vitis vinifera] 55 7e-06 XP_010652046.1 PREDICTED: nuclear transcription factor Y subunit... 55 7e-06 >XP_010269452.1 PREDICTED: nuclear transcription factor Y subunit B-4 [Nelumbo nucifera] Length = 179 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +1 Query: 1 DYAEPLKRYLHRFRELEGDKANQHKASNSE 90 DYAEPLKRYLHRFRELEG+KANQ K SN E Sbjct: 111 DYAEPLKRYLHRFRELEGEKANQDKGSNIE 140 >CBI32238.3 unnamed protein product, partial [Vitis vinifera] Length = 128 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 DYAEPLKRYLHRFRELEGDKANQHKASNSEE 93 DYAEPLKRYLHR+RELEG+KANQ KAS + Sbjct: 62 DYAEPLKRYLHRYRELEGEKANQSKASEEND 92 >CDP03522.1 unnamed protein product [Coffea canephora] Length = 181 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 1 DYAEPLKRYLHRFRELEGDKANQHKASNSEE 93 +YAEPLKRYL+RFRELEG++ANQ+K+ NSEE Sbjct: 112 EYAEPLKRYLNRFRELEGERANQNKSGNSEE 142 >KYP71486.1 Nuclear transcription factor Y subunit B-5 [Cajanus cajan] Length = 151 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = +1 Query: 1 DYAEPLKRYLHRFRELEGDKANQHKASNSEE 93 DY +PLKRYLH++RELEG+KANQ+KA+NS E Sbjct: 113 DYTDPLKRYLHKYRELEGEKANQNKANNSYE 143 >CAN82321.1 hypothetical protein VITISV_021316 [Vitis vinifera] Length = 175 Score = 55.1 bits (131), Expect = 7e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 DYAEPLKRYLHRFRELEGDKANQHKASNSEE 93 DYAEPLKRYLHR+RELEG+KANQ KAS + Sbjct: 109 DYAEPLKRYLHRYRELEGEKANQSKASEEND 139 >XP_010652046.1 PREDICTED: nuclear transcription factor Y subunit B-5 [Vitis vinifera] Length = 175 Score = 55.1 bits (131), Expect = 7e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +1 Query: 1 DYAEPLKRYLHRFRELEGDKANQHKASNSEE 93 DYAEPLKRYLHR+RELEG+KANQ KAS + Sbjct: 109 DYAEPLKRYLHRYRELEGEKANQSKASEEND 139