BLASTX nr result
ID: Panax25_contig00032854
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032854 (463 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AQL04288.1 Transducin/WD40 repeat-like superfamily protein [Zea ... 64 2e-10 OIV98215.1 hypothetical protein TanjilG_18754 [Lupinus angustifo... 64 3e-10 KVI05983.1 Protein kinase, catalytic domain-containing protein [... 67 6e-10 AFK42161.1 unknown [Lotus japonicus] 62 8e-10 XP_015573823.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 9e-10 XP_006385489.1 hypothetical protein POPTR_0003s05820g [Populus t... 65 9e-10 XP_002517562.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_004951509.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_009388533.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_002285272.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_009402893.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 OAY52879.1 hypothetical protein MANES_04G118500 [Manihot esculenta] 65 1e-09 OAY36797.1 hypothetical protein MANES_11G049000 [Manihot esculenta] 65 1e-09 XP_015944501.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_011040004.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_002298116.1 transducin family protein [Populus trichocarpa] E... 65 1e-09 XP_002303265.1 transducin family protein [Populus trichocarpa] E... 65 1e-09 OMP00204.1 hypothetical protein COLO4_12868 [Corchorus olitorius] 65 1e-09 XP_014510124.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 XP_017407089.1 PREDICTED: serine-threonine kinase receptor-assoc... 65 1e-09 >AQL04288.1 Transducin/WD40 repeat-like superfamily protein [Zea mays] Length = 91 Score = 63.5 bits (153), Expect = 2e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 M+KKKVA+PLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MEKKKVAIPLVCHGHSRPVVDLFYSPVTP 29 >OIV98215.1 hypothetical protein TanjilG_18754 [Lupinus angustifolius] Length = 129 Score = 63.9 bits (154), Expect = 3e-10 Identities = 27/29 (93%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKK++AVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKRIAVPLVCHGHSRPVVDLFYSPVTP 29 >KVI05983.1 Protein kinase, catalytic domain-containing protein [Cynara cardunculus var. scolymus] Length = 541 Score = 66.6 bits (161), Expect = 6e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 357 IFILWEMDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 +F+ MDKKKVAVPLVCHGHSRPVVDLFYSP+TP Sbjct: 214 VFLRGLMDKKKVAVPLVCHGHSRPVVDLFYSPITP 248 >AFK42161.1 unknown [Lotus japonicus] Length = 96 Score = 62.0 bits (149), Expect = 8e-10 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 M+KKKVAVPLVCHGH RPVVDLFYSPVTP Sbjct: 1 MEKKKVAVPLVCHGHPRPVVDLFYSPVTP 29 >XP_015573823.1 PREDICTED: serine-threonine kinase receptor-associated protein isoform X2 [Ricinus communis] Length = 297 Score = 65.5 bits (158), Expect = 9e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_006385489.1 hypothetical protein POPTR_0003s05820g [Populus trichocarpa] ERP63286.1 hypothetical protein POPTR_0003s05820g [Populus trichocarpa] Length = 298 Score = 65.5 bits (158), Expect = 9e-10 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_002517562.1 PREDICTED: serine-threonine kinase receptor-associated protein isoform X1 [Ricinus communis] EEF44726.1 serine-threonine kinase receptor-associated protein, putative [Ricinus communis] Length = 336 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_004951509.1 PREDICTED: serine-threonine kinase receptor-associated protein-like [Setaria italica] KQL28190.1 hypothetical protein SETIT_017714mg [Setaria italica] Length = 341 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_009388533.1 PREDICTED: serine-threonine kinase receptor-associated protein [Musa acuminata subsp. malaccensis] Length = 342 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_002285272.1 PREDICTED: serine-threonine kinase receptor-associated protein isoform X2 [Vitis vinifera] CBI36243.3 unnamed protein product, partial [Vitis vinifera] Length = 346 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_009402893.1 PREDICTED: serine-threonine kinase receptor-associated protein-like [Musa acuminata subsp. malaccensis] Length = 347 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >OAY52879.1 hypothetical protein MANES_04G118500 [Manihot esculenta] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >OAY36797.1 hypothetical protein MANES_11G049000 [Manihot esculenta] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_015944501.1 PREDICTED: serine-threonine kinase receptor-associated protein-like [Arachis duranensis] XP_016179643.1 PREDICTED: serine-threonine kinase receptor-associated protein-like [Arachis ipaensis] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_011040004.1 PREDICTED: serine-threonine kinase receptor-associated protein [Populus euphratica] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_002298116.1 transducin family protein [Populus trichocarpa] EEE82921.1 transducin family protein [Populus trichocarpa] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_002303265.1 transducin family protein [Populus trichocarpa] EEE78244.1 transducin family protein [Populus trichocarpa] Length = 350 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >OMP00204.1 hypothetical protein COLO4_12868 [Corchorus olitorius] Length = 352 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_014510124.1 PREDICTED: serine-threonine kinase receptor-associated protein-like [Vigna radiata var. radiata] Length = 352 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29 >XP_017407089.1 PREDICTED: serine-threonine kinase receptor-associated protein-like [Vigna angularis] KOM33079.1 hypothetical protein LR48_Vigan01g263500 [Vigna angularis] BAT76405.1 hypothetical protein VIGAN_01439900 [Vigna angularis var. angularis] Length = 352 Score = 65.5 bits (158), Expect = 1e-09 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +3 Query: 375 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 461 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP Sbjct: 1 MDKKKVAVPLVCHGHSRPVVDLFYSPVTP 29