BLASTX nr result
ID: Panax25_contig00032771
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032771 (1240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014626143.1 PREDICTED: nucleolar MIF4G domain-containing prot... 59 6e-07 KHN03624.1 Nucleolar MIF4G domain-containing protein 1 [Glycine ... 59 1e-06 KRG99809.1 hypothetical protein GLYMA_18G172200 [Glycine max] 59 3e-06 KYP72705.1 Nucleolar MIF4G domain-containing protein 1, partial ... 60 3e-06 KOM38568.1 hypothetical protein LR48_Vigan03g195000 [Vigna angul... 60 5e-06 XP_017418600.1 PREDICTED: nucleolar MIF4G domain-containing prot... 60 5e-06 KHN34673.1 Nucleolar MIF4G domain-containing protein 1 [Glycine ... 60 5e-06 XP_003553340.1 PREDICTED: nucleolar MIF4G domain-containing prot... 60 5e-06 XP_014627557.1 PREDICTED: nucleolar MIF4G domain-containing prot... 60 5e-06 >XP_014626143.1 PREDICTED: nucleolar MIF4G domain-containing protein 1-like [Glycine max] Length = 166 Score = 59.3 bits (142), Expect = 6e-07 Identities = 28/48 (58%), Positives = 33/48 (68%) Frame = +3 Query: 1050 ALNVYLLCSFSNI*SLFAVDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 A+ V ++ + + VD ILI G KWSKLLDPDKKGQWWLSGD A Sbjct: 13 AVGVPVVLGYHGRIDVLRVDDILIRGFKWSKLLDPDKKGQWWLSGDVA 60 >KHN03624.1 Nucleolar MIF4G domain-containing protein 1 [Glycine soja] Length = 159 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI G KWSKLLDPDKKGQWWLSGD A Sbjct: 24 VDDILIRGFKWSKLLDPDKKGQWWLSGDVA 53 >KRG99809.1 hypothetical protein GLYMA_18G172200 [Glycine max] Length = 259 Score = 58.9 bits (141), Expect = 3e-06 Identities = 27/34 (79%), Positives = 27/34 (79%) Frame = +3 Query: 1092 SLFAVDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 S VD ILI G KWSKLLDPDKKGQWWLSGD A Sbjct: 54 SKLRVDDILIRGFKWSKLLDPDKKGQWWLSGDVA 87 >KYP72705.1 Nucleolar MIF4G domain-containing protein 1, partial [Cajanus cajan] Length = 694 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI GLKWSKLLDPDKKGQWWLSGD A Sbjct: 431 VDDILIRGLKWSKLLDPDKKGQWWLSGDLA 460 >KOM38568.1 hypothetical protein LR48_Vigan03g195000 [Vigna angularis] Length = 746 Score = 60.1 bits (144), Expect = 5e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI GLKWSKLLDPDKKGQWWLSGD A Sbjct: 483 VDDILIRGLKWSKLLDPDKKGQWWLSGDAA 512 >XP_017418600.1 PREDICTED: nucleolar MIF4G domain-containing protein 1 isoform X1 [Vigna angularis] XP_017418601.1 PREDICTED: nucleolar MIF4G domain-containing protein 1 isoform X2 [Vigna angularis] BAT84954.1 hypothetical protein VIGAN_04244000 [Vigna angularis var. angularis] Length = 789 Score = 60.1 bits (144), Expect = 5e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI GLKWSKLLDPDKKGQWWLSGD A Sbjct: 526 VDDILIRGLKWSKLLDPDKKGQWWLSGDAA 555 >KHN34673.1 Nucleolar MIF4G domain-containing protein 1 [Glycine soja] Length = 791 Score = 60.1 bits (144), Expect = 5e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI GLKWSKLLDPDKKGQWWLSGD A Sbjct: 528 VDDILIRGLKWSKLLDPDKKGQWWLSGDVA 557 >XP_003553340.1 PREDICTED: nucleolar MIF4G domain-containing protein 1-like isoform X2 [Glycine max] KRG94869.1 hypothetical protein GLYMA_19G114400 [Glycine max] Length = 794 Score = 60.1 bits (144), Expect = 5e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI GLKWSKLLDPDKKGQWWLSGD A Sbjct: 531 VDDILIRGLKWSKLLDPDKKGQWWLSGDVA 560 >XP_014627557.1 PREDICTED: nucleolar MIF4G domain-containing protein 1-like isoform X1 [Glycine max] Length = 823 Score = 60.1 bits (144), Expect = 5e-06 Identities = 27/30 (90%), Positives = 27/30 (90%) Frame = +3 Query: 1104 VDKILICGLKWSKLLDPDKKGQWWLSGDWA 1193 VD ILI GLKWSKLLDPDKKGQWWLSGD A Sbjct: 531 VDDILIRGLKWSKLLDPDKKGQWWLSGDVA 560