BLASTX nr result
ID: Panax25_contig00032684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032684 (1207 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019256703.1 PREDICTED: zinc finger BED domain-containing prot... 50 8e-06 >XP_019256703.1 PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana attenuata] Length = 787 Score = 49.7 bits (117), Expect(2) = 8e-06 Identities = 26/79 (32%), Positives = 41/79 (51%) Frame = -1 Query: 343 LPISSNTSQVPNDGGDNRGCETQNPKEVEEIEQIIGKTRAIIWEHYIRFKQNDEIKAKCK 164 + + SNT+ + D D+R + P R+ +W H+ +F+ N KA+C+ Sbjct: 18 ITVDSNTNTI--DTQDSRKRKAMQP-------------RSDVWNHFDKFEVNGVGKARCR 62 Query: 163 YCGQVLKANSEKNGTSGFK 107 YC Q ANS +NGT+G K Sbjct: 63 YCKQAYAANSSRNGTTGLK 81 Score = 29.6 bits (65), Expect(2) = 8e-06 Identities = 17/41 (41%), Positives = 20/41 (48%) Frame = -2 Query: 129 RMGQVVLRNHNARCKLYPPNIQLKERK*AILNFPPSNISEG 7 R G L+NH RCK YP NI K+ +NF EG Sbjct: 74 RNGTTGLKNHLLRCKEYPLNID-KDNSQTKINFQSCQNDEG 113