BLASTX nr result
ID: Panax25_contig00032587
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032587 (368 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN79405.1 hypothetical protein VITISV_000709 [Vitis vinifera] 200 7e-62 XP_010650726.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 200 1e-60 GAV67132.1 BTB domain-containing protein/zf-TAZ domain-containin... 196 2e-59 KDO47990.1 hypothetical protein CISIN_1g039069mg, partial [Citru... 192 5e-59 XP_018839367.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 194 7e-59 XP_018839366.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 194 1e-58 XP_016508389.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 193 5e-58 XP_009590711.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 193 5e-58 XP_019245842.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 193 5e-58 XP_010242480.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 XP_009358386.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 XP_006492752.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 XP_012075384.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 XP_016462735.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 XP_009780836.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 OMO71244.1 Zinc finger, TAZ-type, partial [Corchorus capsularis] 192 1e-57 XP_007033651.2 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 EOY04577.1 BTB and TAZ domain protein 3 isoform 1 [Theobroma cacao] 192 1e-57 XP_015165788.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 191 1e-57 XP_004287161.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 192 1e-57 >CAN79405.1 hypothetical protein VITISV_000709 [Vitis vinifera] Length = 306 Score = 200 bits (508), Expect = 7e-62 Identities = 97/115 (84%), Positives = 103/115 (89%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR CDAPRLS IC RM+V DFKTISSTQGWKVM +PALE ELLE +VEADS K+ERLK Sbjct: 107 ARKCDAPRLSLICTRMIVKDFKTISSTQGWKVMKRVDPALEQELLEAVVEADSRKEERLK 166 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLKGSQVAC FPACKGLETLV Sbjct: 167 KIEEKKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACGFPACKGLETLV 221 >XP_010650726.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] XP_010650727.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] XP_019075766.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Vitis vinifera] CBI24713.3 unnamed protein product, partial [Vitis vinifera] Length = 407 Score = 200 bits (508), Expect = 1e-60 Identities = 97/115 (84%), Positives = 103/115 (89%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR CDAPRLS IC RM+V DFKTISSTQGWKVM +PALE ELLE +VEADS K+ERLK Sbjct: 208 ARKCDAPRLSLICTRMIVKDFKTISSTQGWKVMKRVDPALEQELLEAVVEADSRKEERLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLKGSQVAC FPACKGLETLV Sbjct: 268 KIEEKKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACGFPACKGLETLV 322 >GAV67132.1 BTB domain-containing protein/zf-TAZ domain-containing protein [Cephalotus follicularis] Length = 407 Score = 196 bits (499), Expect = 2e-59 Identities = 93/115 (80%), Positives = 105/115 (91%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLSF+C RMVV DFKTISST+GWKVM ANP LE EL+E +VEADS QERL+ Sbjct: 208 ARNCDAPRLSFVCIRMVVKDFKTISSTEGWKVMKRANPTLEQELVEFVVEADSRNQERLR 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQL++AMEAL+HI RDGCRTIGPRDKVL+GSQVAC+FPACKGLETLV Sbjct: 268 KIEEKKVYLQLYQAMEALLHICRDGCRTIGPRDKVLRGSQVACNFPACKGLETLV 322 >KDO47990.1 hypothetical protein CISIN_1g039069mg, partial [Citrus sinensis] Length = 293 Score = 192 bits (488), Expect = 5e-59 Identities = 90/115 (78%), Positives = 103/115 (89%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLS IC RMVV DFK I+ST+GWK+M ANPALE EL+E +V+ DS KQERL+ Sbjct: 94 ARNCDAPRLSLICVRMVVKDFKAITSTEGWKIMKRANPALEQELVESVVDEDSRKQERLR 153 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EE++VYLQLHEAMEAL+HI RDGCRTIGPRDKVLKGSQVAC+FPACKGLE LV Sbjct: 154 KVEERKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACNFPACKGLEALV 208 >XP_018839367.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X2 [Juglans regia] Length = 383 Score = 194 bits (494), Expect = 7e-59 Identities = 94/115 (81%), Positives = 102/115 (88%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLSFIC R ++ DFKTISST+GWKVM ANP LE ELLE +VEADS KQERLK Sbjct: 190 ARNCDAPRLSFICVRTIIGDFKTISSTEGWKVMKRANPELEQELLECVVEADSRKQERLK 249 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQL+EAMEAL+HI RDGCRTIGPRDK LKGSQVAC FPACKGLE LV Sbjct: 250 KIEEKKVYLQLNEAMEALLHICRDGCRTIGPRDKALKGSQVACRFPACKGLEMLV 304 >XP_018839366.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X1 [Juglans regia] Length = 401 Score = 194 bits (494), Expect = 1e-58 Identities = 94/115 (81%), Positives = 102/115 (88%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLSFIC R ++ DFKTISST+GWKVM ANP LE ELLE +VEADS KQERLK Sbjct: 208 ARNCDAPRLSFICVRTIIGDFKTISSTEGWKVMKRANPELEQELLECVVEADSRKQERLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQL+EAMEAL+HI RDGCRTIGPRDK LKGSQVAC FPACKGLE LV Sbjct: 268 KIEEKKVYLQLNEAMEALLHICRDGCRTIGPRDKALKGSQVACRFPACKGLEMLV 322 >XP_016508389.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] Length = 406 Score = 193 bits (490), Expect = 5e-58 Identities = 92/115 (80%), Positives = 101/115 (87%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRL+ C RM+V +FK ISST+GWKVM ANP LE ELLE +VEADS KQ+RLK Sbjct: 208 ARNCDAPRLTLFCIRMIVRNFKNISSTEGWKVMRQANPVLEQELLEFVVEADSRKQDRLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLK SQ ACSFPACKGLETLV Sbjct: 268 KIEEKKVYLQLHEAMEALVHICRDGCRTIGPRDKVLKASQAACSFPACKGLETLV 322 >XP_009590711.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] XP_009590712.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] XP_009590713.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] XP_009590714.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] XP_018623497.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] XP_018623498.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] XP_018623499.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana tomentosiformis] Length = 406 Score = 193 bits (490), Expect = 5e-58 Identities = 92/115 (80%), Positives = 101/115 (87%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRL+ C RM+V +FK ISST+GWKVM ANP LE ELLE +VEADS KQ+RLK Sbjct: 208 ARNCDAPRLTLFCIRMIVRNFKNISSTEGWKVMRQANPVLEQELLEFVVEADSRKQDRLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLK SQ ACSFPACKGLETLV Sbjct: 268 KIEEKKVYLQLHEAMEALVHICRDGCRTIGPRDKVLKASQAACSFPACKGLETLV 322 >XP_019245842.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana attenuata] XP_019245843.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana attenuata] XP_019245844.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana attenuata] XP_019245845.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana attenuata] OIT03522.1 btbpoz and taz domain-containing protein 3 [Nicotiana attenuata] Length = 408 Score = 193 bits (490), Expect = 5e-58 Identities = 92/115 (80%), Positives = 101/115 (87%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRL+ C RM+V +FK ISST+GWKVM ANP LE ELLE +VEADS KQ+RLK Sbjct: 210 ARNCDAPRLTLFCIRMIVRNFKNISSTEGWKVMRQANPVLEQELLEFVVEADSRKQDRLK 269 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLK SQ ACSFPACKGLETLV Sbjct: 270 KIEEKKVYLQLHEAMEALVHICRDGCRTIGPRDKVLKASQAACSFPACKGLETLV 324 >XP_010242480.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_010242481.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_010242482.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_010242483.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_019051457.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_019051458.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_019051459.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] XP_019051460.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nelumbo nucifera] Length = 406 Score = 192 bits (488), Expect = 1e-57 Identities = 88/115 (76%), Positives = 105/115 (91%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR CDAPRLS IC R+++ DFKT+S+T+GWKVM A+PALE E+LEL+VEADS+K E++K Sbjct: 208 ARQCDAPRLSLICVRLILKDFKTVSATEGWKVMRKADPALEQEILELVVEADSNKHEKMK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EEK++YLQLHEAMEAL+HI +DGCRTIGPRDKVLKGSQVAC FPACKGLETLV Sbjct: 268 KMEEKRMYLQLHEAMEALLHICKDGCRTIGPRDKVLKGSQVACGFPACKGLETLV 322 >XP_009358386.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Pyrus x bretschneideri] Length = 407 Score = 192 bits (488), Expect = 1e-57 Identities = 92/115 (80%), Positives = 101/115 (87%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLS IC RM+V DFK ISST+GWKVM NPALE ELLE +VEADS K+ERLK Sbjct: 208 ARNCDAPRLSLICVRMIVKDFKAISSTEGWKVMKRVNPALEQELLEFVVEADSRKEERLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K EEK+VYLQL+EAMEAL+HI RDGC+TIGPRDKV KGSQVAC FPACKGLETLV Sbjct: 268 KKEEKKVYLQLYEAMEALLHICRDGCKTIGPRDKVFKGSQVACGFPACKGLETLV 322 >XP_006492752.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Citrus sinensis] XP_006492753.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Citrus sinensis] XP_015380862.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Citrus sinensis] Length = 407 Score = 192 bits (488), Expect = 1e-57 Identities = 90/115 (78%), Positives = 103/115 (89%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLS IC RMVV DFK I+ST+GWK+M ANPALE EL+E +V+ DS KQERL+ Sbjct: 208 ARNCDAPRLSLICVRMVVKDFKAITSTEGWKIMKRANPALEQELVESVVDEDSRKQERLR 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EE++VYLQLHEAMEAL+HI RDGCRTIGPRDKVLKGSQVAC+FPACKGLE LV Sbjct: 268 KVEERKVYLQLHEAMEALLHICRDGCRTIGPRDKVLKGSQVACNFPACKGLEALV 322 >XP_012075384.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Jatropha curcas] XP_012075385.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Jatropha curcas] KDP35133.1 hypothetical protein JCGZ_10667 [Jatropha curcas] Length = 411 Score = 192 bits (488), Expect = 1e-57 Identities = 94/115 (81%), Positives = 101/115 (87%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR CDAPRLSFIC RMVV DFK+ISST+GWKVM ANPALE ELLE +VEADS KQE LK Sbjct: 208 ARCCDAPRLSFICVRMVVKDFKSISSTEGWKVMKRANPALEQELLESVVEADSRKQEMLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EEK+VY QL+EAMEAL+HI RDGCRTIGPRDKVLKGSQV C FPACKGLE LV Sbjct: 268 KMEEKKVYFQLYEAMEALLHICRDGCRTIGPRDKVLKGSQVICKFPACKGLENLV 322 >XP_016462735.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] XP_016462743.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] XP_016462751.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] XP_016462755.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like [Nicotiana tabacum] Length = 402 Score = 192 bits (487), Expect = 1e-57 Identities = 92/115 (80%), Positives = 100/115 (86%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR CDAPRL+ C RM+V +FK ISST+GWKVM ANP LE ELLE +VEADS KQ+RLK Sbjct: 208 ARSCDAPRLTLFCIRMIVRNFKNISSTEGWKVMRQANPVLEQELLESVVEADSRKQDRLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLK SQ ACSFPACKGLETLV Sbjct: 268 KIEEKKVYLQLHEAMEALVHICRDGCRTIGPRDKVLKASQAACSFPACKGLETLV 322 >XP_009780836.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] XP_009780837.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] XP_009780838.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] XP_009780839.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Nicotiana sylvestris] Length = 402 Score = 192 bits (487), Expect = 1e-57 Identities = 92/115 (80%), Positives = 100/115 (86%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR CDAPRL+ C RM+V +FK ISST+GWKVM ANP LE ELLE +VEADS KQ+RLK Sbjct: 208 ARSCDAPRLTLFCIRMIVRNFKNISSTEGWKVMRQANPVLEQELLESVVEADSRKQDRLK 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGPRDKVLK SQ ACSFPACKGLETLV Sbjct: 268 KIEEKKVYLQLHEAMEALVHICRDGCRTIGPRDKVLKASQAACSFPACKGLETLV 322 >OMO71244.1 Zinc finger, TAZ-type, partial [Corchorus capsularis] Length = 403 Score = 192 bits (487), Expect = 1e-57 Identities = 91/115 (79%), Positives = 104/115 (90%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRL+ IC RMVV DFK+ISST+GWKVM NPALE EL+E +VEADS KQER + Sbjct: 208 ARNCDAPRLALICVRMVVKDFKSISSTEGWKVMKRVNPALEQELVEAVVEADSRKQERQR 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EEK+VYLQL+EAMEAL+HI +DGCRTIGPRDKVLKGSQVAC+FPACKGLETLV Sbjct: 268 KLEEKKVYLQLYEAMEALLHICKDGCRTIGPRDKVLKGSQVACNFPACKGLETLV 322 >XP_007033651.2 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 isoform X2 [Theobroma cacao] XP_017975796.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 isoform X2 [Theobroma cacao] XP_017975797.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 isoform X2 [Theobroma cacao] Length = 407 Score = 192 bits (487), Expect = 1e-57 Identities = 90/115 (78%), Positives = 105/115 (91%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 A++CDAPRL+FIC RM+V DFK+ISST+GWKVM ANPALE EL+E +VEADS KQER + Sbjct: 208 AKNCDAPRLAFICVRMIVKDFKSISSTEGWKVMKRANPALEQELVESVVEADSRKQERQR 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EEK+VYLQL+EAMEAL+HI +DGCRTIGPRDKVLKGSQV C+FPACKGLETLV Sbjct: 268 KMEEKKVYLQLYEAMEALLHICKDGCRTIGPRDKVLKGSQVTCNFPACKGLETLV 322 >EOY04577.1 BTB and TAZ domain protein 3 isoform 1 [Theobroma cacao] Length = 407 Score = 192 bits (487), Expect = 1e-57 Identities = 90/115 (78%), Positives = 105/115 (91%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 A++CDAPRL+FIC RM+V DFK+ISST+GWKVM ANPALE EL+E +VEADS KQER + Sbjct: 208 AKNCDAPRLAFICVRMIVKDFKSISSTEGWKVMKRANPALEQELVESVVEADSRKQERQR 267 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K+EEK+VYLQL+EAMEAL+HI +DGCRTIGPRDKVLKGSQV C+FPACKGLETLV Sbjct: 268 KMEEKKVYLQLYEAMEALLHICKDGCRTIGPRDKVLKGSQVTCNFPACKGLETLV 322 >XP_015165788.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3-like isoform X3 [Solanum tuberosum] Length = 394 Score = 191 bits (486), Expect = 1e-57 Identities = 92/115 (80%), Positives = 102/115 (88%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 ARDCDAPRL+ C RMVV +FK+ISST+GWKVM ANPALE ELLE +VEAD+ KQ+RLK Sbjct: 205 ARDCDAPRLTLFCIRMVVGNFKSISSTEGWKVMRRANPALEQELLEFVVEADTRKQDRLK 264 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 KIEEK+VYLQLHEAMEAL+HI RDGCRTIGP DKVLK SQ ACSFPACKGLE+LV Sbjct: 265 KIEEKKVYLQLHEAMEALVHICRDGCRTIGPHDKVLKASQEACSFPACKGLESLV 319 >XP_004287161.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Fragaria vesca subsp. vesca] Length = 409 Score = 192 bits (487), Expect = 1e-57 Identities = 92/115 (80%), Positives = 101/115 (87%) Frame = +1 Query: 1 ARDCDAPRLSFICARMVVTDFKTISSTQGWKVMTHANPALEHELLELIVEADSSKQERLK 180 AR+CDAPRLS IC RM+V DFK ISST+GWKVM NPALE ELLE +VEADS K+ERLK Sbjct: 210 ARNCDAPRLSLICVRMIVKDFKAISSTEGWKVMKKVNPALEQELLEFLVEADSGKEERLK 269 Query: 181 KIEEKQVYLQLHEAMEALIHIFRDGCRTIGPRDKVLKGSQVACSFPACKGLETLV 345 K EEK+VYLQL+EAMEAL+HI +DGCRTIGPRDKV KGSQVAC FPACKGLETLV Sbjct: 270 KKEEKKVYLQLYEAMEALLHICKDGCRTIGPRDKVFKGSQVACGFPACKGLETLV 324