BLASTX nr result
ID: Panax25_contig00032584
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032584 (553 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243502.1 PREDICTED: serine/threonine-protein kinase STY46-... 66 2e-09 >XP_017243502.1 PREDICTED: serine/threonine-protein kinase STY46-like [Daucus carota subsp. sativus] Length = 573 Score = 65.9 bits (159), Expect = 2e-09 Identities = 31/51 (60%), Positives = 40/51 (78%) Frame = -1 Query: 553 PSLRPDFSEIIRMLHHIEKTVAEEDRPGKRQNHVGKFSLLLEGSSLKREEN 401 P LRP+FSEII +L HI KTV EE++P KR+N VG++S L +G S+K EEN Sbjct: 523 PFLRPEFSEIIDILQHIAKTVGEEEKPVKRRNRVGEYSQLRQGCSVKSEEN 573