BLASTX nr result
ID: Panax25_contig00032419
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032419 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY56422.1 hypothetical protein MANES_02G015100 [Manihot esculenta] 77 2e-13 XP_017235000.1 PREDICTED: calcium-dependent protein kinase 3-lik... 76 3e-13 XP_018829273.1 PREDICTED: calcium-dependent protein kinase 1-lik... 75 4e-13 KHN25667.1 Calcium-dependent protein kinase 3 [Glycine soja] 75 5e-13 XP_018837191.1 PREDICTED: calcium-dependent protein kinase 1-lik... 75 6e-13 KRH77599.1 hypothetical protein GLYMA_01G223200 [Glycine max] 75 6e-13 XP_003517491.3 PREDICTED: calcium-dependent protein kinase 3-lik... 75 6e-13 XP_019151661.1 PREDICTED: calcium-dependent protein kinase 1-lik... 75 8e-13 XP_010251583.1 PREDICTED: calcium-dependent protein kinase 1-lik... 75 8e-13 XP_002509886.1 PREDICTED: calcium-dependent protein kinase 3 [Ri... 75 8e-13 XP_015896537.1 PREDICTED: calcium-dependent protein kinase 3 [Zi... 75 8e-13 XP_009334485.1 PREDICTED: calcium-dependent protein kinase 3 [Py... 74 1e-12 XP_012086799.1 PREDICTED: calcium-dependent protein kinase 3 [Ja... 74 1e-12 XP_010261434.1 PREDICTED: calcium-dependent protein kinase 1-lik... 74 1e-12 KHN35055.1 Calcium-dependent protein kinase 3 [Glycine soja] 73 2e-12 XP_003538256.1 PREDICTED: calcium-dependent protein kinase 3 [Gl... 73 3e-12 XP_004298849.1 PREDICTED: calcium-dependent protein kinase 3 [Fr... 73 3e-12 XP_008239005.2 PREDICTED: calcium-dependent protein kinase 3 [Pr... 73 4e-12 XP_008451994.1 PREDICTED: calcium-dependent protein kinase 3 [Cu... 73 4e-12 KJB52214.1 hypothetical protein B456_008G251000 [Gossypium raimo... 72 4e-12 >OAY56422.1 hypothetical protein MANES_02G015100 [Manihot esculenta] Length = 459 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDGRINY+EFVAMMRKG+PELVTNRRRK Sbjct: 422 KEIIAEVDTDNDGRINYEEFVAMMRKGNPELVTNRRRK 459 >XP_017235000.1 PREDICTED: calcium-dependent protein kinase 3-like [Daucus carota subsp. sativus] KZN06014.1 hypothetical protein DCAR_006851 [Daucus carota subsp. sativus] Length = 521 Score = 75.9 bits (185), Expect = 3e-13 Identities = 36/38 (94%), Positives = 37/38 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDGRINYDEFV MMRKG+PELVTNRRRK Sbjct: 484 KEIIAEVDTDNDGRINYDEFVDMMRKGNPELVTNRRRK 521 >XP_018829273.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] Length = 515 Score = 75.5 bits (184), Expect = 4e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDGRINYDEFV MMRKG+P+LVTNRRRK Sbjct: 478 KEIIAEVDTDNDGRINYDEFVTMMRKGNPDLVTNRRRK 515 >KHN25667.1 Calcium-dependent protein kinase 3 [Glycine soja] Length = 383 Score = 75.1 bits (183), Expect = 5e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEII EVDTDNDGRINYDEFVAMMRKG P+LVTNRRRK Sbjct: 346 KEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 383 >XP_018837191.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] XP_018837192.1 PREDICTED: calcium-dependent protein kinase 1-like [Juglans regia] Length = 521 Score = 75.1 bits (183), Expect = 6e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDGRINYDEFV MMRKG+P+L+TNRRRK Sbjct: 484 KEIIAEVDTDNDGRINYDEFVTMMRKGNPDLITNRRRK 521 >KRH77599.1 hypothetical protein GLYMA_01G223200 [Glycine max] Length = 528 Score = 75.1 bits (183), Expect = 6e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEII EVDTDNDGRINYDEFVAMMRKG P+LVTNRRRK Sbjct: 491 KEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 528 >XP_003517491.3 PREDICTED: calcium-dependent protein kinase 3-like [Glycine max] Length = 542 Score = 75.1 bits (183), Expect = 6e-13 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEII EVDTDNDGRINYDEFVAMMRKG P+LVTNRRRK Sbjct: 505 KEIIVEVDTDNDGRINYDEFVAMMRKGKPDLVTNRRRK 542 >XP_019151661.1 PREDICTED: calcium-dependent protein kinase 1-like [Ipomoea nil] Length = 514 Score = 74.7 bits (182), Expect = 8e-13 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDG+INYDEFVAMMRKG+P+LVTNRRR+ Sbjct: 477 KEIIAEVDTDNDGKINYDEFVAMMRKGTPDLVTNRRRR 514 >XP_010251583.1 PREDICTED: calcium-dependent protein kinase 1-like [Nelumbo nucifera] Length = 522 Score = 74.7 bits (182), Expect = 8e-13 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTD+DGRINYDEFVAMMRKG+PEL TNRRRK Sbjct: 485 KEIIAEVDTDHDGRINYDEFVAMMRKGNPELTTNRRRK 522 >XP_002509886.1 PREDICTED: calcium-dependent protein kinase 3 [Ricinus communis] EEF51273.1 calcium-dependent protein kinase, putative [Ricinus communis] Length = 528 Score = 74.7 bits (182), Expect = 8e-13 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTD+DGRINY+EFVAMMRKG+PELVTNRRRK Sbjct: 491 KEIIAEVDTDHDGRINYEEFVAMMRKGNPELVTNRRRK 528 >XP_015896537.1 PREDICTED: calcium-dependent protein kinase 3 [Ziziphus jujuba] Length = 531 Score = 74.7 bits (182), Expect = 8e-13 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDGRINYDEFVAMMRKG+P++ TNRRRK Sbjct: 494 KEIIAEVDTDNDGRINYDEFVAMMRKGNPDMATNRRRK 531 >XP_009334485.1 PREDICTED: calcium-dependent protein kinase 3 [Pyrus x bretschneideri] Length = 525 Score = 74.3 bits (181), Expect = 1e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTD DGRINYDEF AMMRKG+PELVTNRRRK Sbjct: 488 KEIIAEVDTDRDGRINYDEFAAMMRKGNPELVTNRRRK 525 >XP_012086799.1 PREDICTED: calcium-dependent protein kinase 3 [Jatropha curcas] KDP25359.1 hypothetical protein JCGZ_20515 [Jatropha curcas] Length = 525 Score = 74.3 bits (181), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDG+INY+EFVAMMRKG+P+LVTNRRRK Sbjct: 488 KEIIAEVDTDNDGKINYEEFVAMMRKGNPDLVTNRRRK 525 >XP_010261434.1 PREDICTED: calcium-dependent protein kinase 1-like [Nelumbo nucifera] Length = 531 Score = 73.9 bits (180), Expect = 1e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTD+DG+INYDEFVAMM+KG+PELVTNRRRK Sbjct: 494 KEIIAEVDTDHDGKINYDEFVAMMKKGNPELVTNRRRK 531 >KHN35055.1 Calcium-dependent protein kinase 3 [Glycine soja] Length = 373 Score = 73.2 bits (178), Expect = 2e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVD DNDGRINYDEFVAMMRKG+P+LV NRRRK Sbjct: 336 KEIIAEVDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 373 >XP_003538256.1 PREDICTED: calcium-dependent protein kinase 3 [Glycine max] KRH27875.1 hypothetical protein GLYMA_11G020200 [Glycine max] Length = 505 Score = 73.2 bits (178), Expect = 3e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVD DNDGRINYDEFVAMMRKG+P+LV NRRRK Sbjct: 468 KEIIAEVDADNDGRINYDEFVAMMRKGNPDLVNNRRRK 505 >XP_004298849.1 PREDICTED: calcium-dependent protein kinase 3 [Fragaria vesca subsp. vesca] Length = 519 Score = 73.2 bits (178), Expect = 3e-12 Identities = 35/38 (92%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEII EVDTD DGRINYDEFVAMMRKG+PELVTNRRRK Sbjct: 482 KEIITEVDTDLDGRINYDEFVAMMRKGNPELVTNRRRK 519 >XP_008239005.2 PREDICTED: calcium-dependent protein kinase 3 [Prunus mume] Length = 451 Score = 72.8 bits (177), Expect = 4e-12 Identities = 35/38 (92%), Positives = 35/38 (92%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTD DGRINYDEF AMMRKG PELVTNRRRK Sbjct: 414 KEIIAEVDTDLDGRINYDEFAAMMRKGDPELVTNRRRK 451 >XP_008451994.1 PREDICTED: calcium-dependent protein kinase 3 [Cucumis melo] Length = 527 Score = 72.8 bits (177), Expect = 4e-12 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTDNDGRINYDEFVAMMRKG+PEL T RR+K Sbjct: 490 KEIIAEVDTDNDGRINYDEFVAMMRKGNPELTTTRRQK 527 >KJB52214.1 hypothetical protein B456_008G251000 [Gossypium raimondii] Length = 374 Score = 72.4 bits (176), Expect = 4e-12 Identities = 34/38 (89%), Positives = 35/38 (92%) Frame = +1 Query: 1 KEIIAEVDTDNDGRINYDEFVAMMRKGSPELVTNRRRK 114 KEIIAEVDTD DGRINYDEFVAMMRKG+PEL NRRRK Sbjct: 337 KEIIAEVDTDRDGRINYDEFVAMMRKGNPELANNRRRK 374