BLASTX nr result
ID: Panax25_contig00032295
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032295 (1487 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP12970.1 RNA-dependent RNA polymerase, mitoviral [Corchorus ol... 59 4e-06 >OMP12970.1 RNA-dependent RNA polymerase, mitoviral [Corchorus olitorius] Length = 258 Score = 58.9 bits (141), Expect = 4e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = +1 Query: 1087 IFAIGNYVNQRLLRPIHVWLMKVLKTISIGGTFHQERPLVNLIG 1218 +FA+GNYVNQRLL P+H W VLKTI + GTF+Q PL L G Sbjct: 129 LFAVGNYVNQRLLFPLHQWCASVLKTIPMDGTFNQTDPLDRLAG 172