BLASTX nr result
ID: Panax25_contig00032091
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00032091 (961 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009623603.1 PREDICTED: lysM domain receptor-like kinase 3 iso... 74 1e-12 XP_008229995.1 PREDICTED: chitin elicitor receptor kinase 1-like... 79 1e-12 XP_009623601.1 PREDICTED: lysM domain receptor-like kinase 3 iso... 74 1e-12 AEK21793.1 LysM receptor-like kinase variant SlBti9-1a [Solanum ... 79 2e-12 XP_015081611.1 PREDICTED: chitin elicitor receptor kinase 1-like... 79 2e-12 NP_001233773.1 LysM receptor-like kinase isoform 1 precursor [So... 79 2e-12 XP_015081610.1 PREDICTED: chitin elicitor receptor kinase 1-like... 79 2e-12 NP_001233930.2 LysM receptor-like kinase isoform 1a precursor [S... 79 2e-12 EEF37042.1 receptor protein kinase, putative [Ricinus communis] 78 2e-12 XP_015578590.1 PREDICTED: chitin elicitor receptor kinase 1 isof... 78 2e-12 XP_015578589.1 PREDICTED: chitin elicitor receptor kinase 1 isof... 78 2e-12 XP_016580575.1 PREDICTED: chitin elicitor receptor kinase 1-like... 78 3e-12 XP_016580574.1 PREDICTED: chitin elicitor receptor kinase 1-like... 78 3e-12 XP_006357945.1 PREDICTED: chitin elicitor receptor kinase 1-like... 77 8e-12 XP_006357944.1 PREDICTED: chitin elicitor receptor kinase 1-like... 77 8e-12 ONI18395.1 hypothetical protein PRUPE_3G213100 [Prunus persica] 76 1e-11 AKK25222.1 Lyk 3 [Populus x canadensis] 76 1e-11 XP_002301610.1 LysM domain-containing receptor-like kinase 4 fam... 76 1e-11 XP_015868906.1 PREDICTED: chitin elicitor receptor kinase 1-like... 76 1e-11 XP_007214947.1 hypothetical protein PRUPE_ppa003023mg [Prunus pe... 76 1e-11 >XP_009623603.1 PREDICTED: lysM domain receptor-like kinase 3 isoform X2 [Nicotiana tomentosiformis] Length = 134 Score = 73.9 bits (180), Expect = 1e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLV LFEEVLNQP+P EDL +LVDPRLG++YPLDSVRK Sbjct: 40 ESKGLVGLFEEVLNQPEPDEDLRRLVDPRLGNDYPLDSVRK 80 >XP_008229995.1 PREDICTED: chitin elicitor receptor kinase 1-like [Prunus mume] Length = 609 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLV LFEEVLNQPDPKEDL KLVDPRLGD YPLDSVRK Sbjct: 515 ESRGLVGLFEEVLNQPDPKEDLRKLVDPRLGDNYPLDSVRK 555 >XP_009623601.1 PREDICTED: lysM domain receptor-like kinase 3 isoform X1 [Nicotiana tomentosiformis] Length = 137 Score = 73.9 bits (180), Expect = 1e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLV LFEEVLNQP+P EDL +LVDPRLG++YPLDSVRK Sbjct: 43 ESKGLVGLFEEVLNQPEPDEDLRRLVDPRLGNDYPLDSVRK 83 >AEK21793.1 LysM receptor-like kinase variant SlBti9-1a [Solanum lycopersicum] Length = 620 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP EDL +LVDPRLGD+YPLDSVRK Sbjct: 526 ESKGLVALFEEVLNQPDPDEDLRQLVDPRLGDDYPLDSVRK 566 >XP_015081611.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X2 [Solanum pennellii] Length = 626 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP EDL +LVDPRLGD+YPLDSVRK Sbjct: 532 ESKGLVALFEEVLNQPDPDEDLRQLVDPRLGDDYPLDSVRK 572 >NP_001233773.1 LysM receptor-like kinase isoform 1 precursor [Solanum lycopersicum] ADL16642.1 LysM receptor-like kinase [Solanum lycopersicum] Length = 626 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP EDL +LVDPRLGD+YPLDSVRK Sbjct: 532 ESKGLVALFEEVLNQPDPDEDLRQLVDPRLGDDYPLDSVRK 572 >XP_015081610.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X1 [Solanum pennellii] Length = 629 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP EDL +LVDPRLGD+YPLDSVRK Sbjct: 535 ESKGLVALFEEVLNQPDPDEDLRQLVDPRLGDDYPLDSVRK 575 >NP_001233930.2 LysM receptor-like kinase isoform 1a precursor [Solanum lycopersicum] Length = 629 Score = 78.6 bits (192), Expect = 2e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP EDL +LVDPRLGD+YPLDSVRK Sbjct: 535 ESKGLVALFEEVLNQPDPDEDLRQLVDPRLGDDYPLDSVRK 575 >EEF37042.1 receptor protein kinase, putative [Ricinus communis] Length = 603 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLVALFE+VLNQPDPKED+ KLVDPRLGD YPLDSVRK Sbjct: 509 ESRGLVALFEDVLNQPDPKEDVRKLVDPRLGDNYPLDSVRK 549 >XP_015578590.1 PREDICTED: chitin elicitor receptor kinase 1 isoform X2 [Ricinus communis] Length = 616 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLVALFE+VLNQPDPKED+ KLVDPRLGD YPLDSVRK Sbjct: 522 ESRGLVALFEDVLNQPDPKEDVRKLVDPRLGDNYPLDSVRK 562 >XP_015578589.1 PREDICTED: chitin elicitor receptor kinase 1 isoform X1 [Ricinus communis] Length = 625 Score = 78.2 bits (191), Expect = 2e-12 Identities = 36/41 (87%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLVALFE+VLNQPDPKED+ KLVDPRLGD YPLDSVRK Sbjct: 531 ESRGLVALFEDVLNQPDPKEDVRKLVDPRLGDNYPLDSVRK 571 >XP_016580575.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X2 [Capsicum annuum] Length = 626 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP E+L KLVDPRLGD+YPLDSVRK Sbjct: 532 ESKGLVALFEEVLNQPDPDEELPKLVDPRLGDDYPLDSVRK 572 >XP_016580574.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X1 [Capsicum annuum] Length = 626 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQPDP E+L KLVDPRLGD+YPLDSVRK Sbjct: 532 ESKGLVALFEEVLNQPDPDEELPKLVDPRLGDDYPLDSVRK 572 >XP_006357945.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X2 [Solanum tuberosum] Length = 626 Score = 76.6 bits (187), Expect = 8e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQP+P EDL +L+DPRLGD+YPLDSVRK Sbjct: 532 ESKGLVALFEEVLNQPEPDEDLRQLIDPRLGDDYPLDSVRK 572 >XP_006357944.1 PREDICTED: chitin elicitor receptor kinase 1-like isoform X1 [Solanum tuberosum] Length = 629 Score = 76.6 bits (187), Expect = 8e-12 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFEEVLNQP+P EDL +L+DPRLGD+YPLDSVRK Sbjct: 535 ESKGLVALFEEVLNQPEPDEDLRQLIDPRLGDDYPLDSVRK 575 >ONI18395.1 hypothetical protein PRUPE_3G213100 [Prunus persica] Length = 573 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLV LFEEVLNQPDPKEDL KLVDP LGD YPLDSVRK Sbjct: 479 ESRGLVGLFEEVLNQPDPKEDLRKLVDPGLGDNYPLDSVRK 519 >AKK25222.1 Lyk 3 [Populus x canadensis] Length = 581 Score = 76.3 bits (186), Expect = 1e-11 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLVALFE+VLNQPDP+EDL K+VDPRLG++YPLDSVRK Sbjct: 487 ESRGLVALFEDVLNQPDPREDLRKVVDPRLGEDYPLDSVRK 527 >XP_002301610.1 LysM domain-containing receptor-like kinase 4 family protein [Populus trichocarpa] EEE80883.1 LysM domain-containing receptor-like kinase 4 family protein [Populus trichocarpa] Length = 581 Score = 76.3 bits (186), Expect = 1e-11 Identities = 34/41 (82%), Positives = 40/41 (97%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLVALFE+VLNQPDP+EDL K+VDPRLG++YPLDSVRK Sbjct: 487 ESRGLVALFEDVLNQPDPREDLRKVVDPRLGEDYPLDSVRK 527 >XP_015868906.1 PREDICTED: chitin elicitor receptor kinase 1-like [Ziziphus jujuba] Length = 611 Score = 76.3 bits (186), Expect = 1e-11 Identities = 35/41 (85%), Positives = 39/41 (95%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ESKGLVALFE+VLNQPDP+EDL KLVDPRLGD YP+D+VRK Sbjct: 517 ESKGLVALFEDVLNQPDPREDLCKLVDPRLGDNYPIDAVRK 557 >XP_007214947.1 hypothetical protein PRUPE_ppa003023mg [Prunus persica] Length = 611 Score = 76.3 bits (186), Expect = 1e-11 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +3 Query: 3 ESKGLVALFEEVLNQPDPKEDLNKLVDPRLGDEYPLDSVRK 125 ES+GLV LFEEVLNQPDPKEDL KLVDP LGD YPLDSVRK Sbjct: 517 ESRGLVGLFEEVLNQPDPKEDLRKLVDPGLGDNYPLDSVRK 557