BLASTX nr result
ID: Panax25_contig00031968
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031968 (431 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009779244.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana ... 87 2e-17 XP_011094207.1 PREDICTED: calcium-transporting ATPase, endoplasm... 76 2e-17 XP_004510638.1 PREDICTED: calcium-transporting ATPase, endoplasm... 77 2e-17 KZV48564.1 calcium-transporting ATPase, endoplasmic reticulum-ty... 77 3e-17 XP_012843886.1 PREDICTED: LOW QUALITY PROTEIN: calcium-transport... 75 4e-17 EYU32279.1 hypothetical protein MIMGU_mgv1a000676mg [Erythranthe... 75 4e-17 XP_019234313.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana ... 86 6e-17 XP_016489064.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana ... 86 6e-17 XP_009590675.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana ... 85 1e-16 XP_002265804.1 PREDICTED: tubby-like F-box protein 5 [Vitis vini... 85 1e-16 XP_013444583.1 endoplasmic reticulum-type calcium-transporting A... 75 1e-16 XP_004306639.1 PREDICTED: calcium-transporting ATPase, endoplasm... 73 1e-16 AAL35972.1 type IIA calcium ATPase [Medicago truncatula] 75 1e-16 XP_013444582.1 endoplasmic reticulum-type calcium-transporting A... 75 1e-16 XP_003627528.2 endoplasmic reticulum-type calcium-transporting A... 75 1e-16 XP_013444584.1 endoplasmic reticulum-type calcium-transporting A... 75 1e-16 XP_011099633.1 PREDICTED: tubby-like F-box protein 5 [Sesamum in... 85 1e-16 CBI17501.3 unnamed protein product, partial [Vitis vinifera] 84 2e-16 XP_008233097.1 PREDICTED: calcium-transporting ATPase, endoplasm... 73 2e-16 XP_007220597.1 hypothetical protein PRUPE_ppa000654mg [Prunus pe... 73 2e-16 >XP_009779244.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris] XP_009779245.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana sylvestris] XP_016443358.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana tabacum] Length = 411 Score = 87.4 bits (215), Expect = 2e-17 Identities = 49/86 (56%), Positives = 60/86 (69%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA*KNFFFTGPKRE 181 V+P VPA NY I+T SYELNVLRTRGPRRMHC MHSIP SSI++GGTA F P E Sbjct: 225 VSPTVPACNYSIATISYELNVLRTRGPRRMHCAMHSIPFSSIQEGGTAPTPTSFPQPFGE 284 Query: 182 RAS*RSQLVPDLPARELVPDLPAREL 259 ++S S V D A+EL D+ + ++ Sbjct: 285 KSSPSS--VSD--AKELAKDVSSADI 306 >XP_011094207.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Sesamum indicum] Length = 1051 Score = 76.3 bits (186), Expect(2) = 2e-17 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPV+KGTN +F Sbjct: 161 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVMKGTNPVF 202 Score = 40.0 bits (92), Expect(2) = 2e-17 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLPARELVPGDIV LRV Sbjct: 143 LVPDLPARELVPGDIVELRV 162 >XP_004510638.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Cicer arietinum] XP_004510639.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Cicer arietinum] Length = 1056 Score = 77.4 bits (189), Expect(2) = 2e-17 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPVLKGTN IF Sbjct: 166 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVLKGTNPIF 207 Score = 38.5 bits (88), Expect(2) = 2e-17 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 233 VPDLPARELVPGDIVGLRV 289 VPDLPARELVPGDIV LRV Sbjct: 149 VPDLPARELVPGDIVELRV 167 >KZV48564.1 calcium-transporting ATPase, endoplasmic reticulum-type [Dorcoceras hygrometricum] Length = 1057 Score = 76.6 bits (187), Expect(2) = 3e-17 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AV+ TSTLRVEQ+SLTGEAMPVLKGTN IF Sbjct: 164 RVGDKVPADMRVAVMKTSTLRVEQSSLTGEAMPVLKGTNPIF 205 Score = 38.9 bits (89), Expect(2) = 3e-17 Identities = 18/20 (90%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLP+RELVPGDIV LRV Sbjct: 146 LVPDLPSRELVPGDIVELRV 165 >XP_012843886.1 PREDICTED: LOW QUALITY PROTEIN: calcium-transporting ATPase, endoplasmic reticulum-type [Erythranthe guttata] Length = 1054 Score = 75.1 bits (183), Expect(2) = 4e-17 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPVLK TN IF Sbjct: 163 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVLKSTNCIF 204 Score = 40.0 bits (92), Expect(2) = 4e-17 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLPARELVPGDIV LRV Sbjct: 145 LVPDLPARELVPGDIVELRV 164 >EYU32279.1 hypothetical protein MIMGU_mgv1a000676mg [Erythranthe guttata] Length = 1022 Score = 75.1 bits (183), Expect(2) = 4e-17 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPVLK TN IF Sbjct: 163 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVLKSTNCIF 204 Score = 40.0 bits (92), Expect(2) = 4e-17 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLPARELVPGDIV LRV Sbjct: 145 LVPDLPARELVPGDIVELRV 164 >XP_019234313.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana attenuata] XP_019234314.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana attenuata] XP_019234315.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana attenuata] XP_019234316.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana attenuata] OIT26821.1 tubby-like f-box protein 5 [Nicotiana attenuata] Length = 411 Score = 85.9 bits (211), Expect = 6e-17 Identities = 49/81 (60%), Positives = 57/81 (70%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA*KNFFFTGPKRE 181 V+P VPA NY I+T SYELNVLRTRGPRRMHC MHSIP SSI++GGTA F P E Sbjct: 225 VSPTVPACNYSIATISYELNVLRTRGPRRMHCAMHSIPFSSIQEGGTAPTPTSFPQPFGE 284 Query: 182 RAS*RSQLVPDLPARELVPDL 244 ++S S V D A+EL D+ Sbjct: 285 KSSPPS--VSD--AKELAKDV 301 >XP_016489064.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana tabacum] Length = 411 Score = 85.9 bits (211), Expect = 6e-17 Identities = 49/81 (60%), Positives = 57/81 (70%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA*KNFFFTGPKRE 181 V+P VPA NY I+T SYELNVLRTRGPRRMHC MHSIP SSI++GGTA F P E Sbjct: 225 VSPTVPACNYSIATISYELNVLRTRGPRRMHCAMHSIPFSSIQEGGTAPTPTSFPQPFGE 284 Query: 182 RAS*RSQLVPDLPARELVPDL 244 ++S S V D A+EL D+ Sbjct: 285 KSSPPS--VSD--AKELAKDV 301 >XP_009590675.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis] XP_018623483.1 PREDICTED: tubby-like F-box protein 5 [Nicotiana tomentosiformis] Length = 411 Score = 85.1 bits (209), Expect = 1e-16 Identities = 49/81 (60%), Positives = 56/81 (69%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA*KNFFFTGPKRE 181 V+P VPA NY I+T SYELNVLRTRGPRRMHC MHSIP SSI++GGTA F P E Sbjct: 225 VSPTVPACNYSIATISYELNVLRTRGPRRMHCAMHSIPFSSIQEGGTAPTPTSFPQPFGE 284 Query: 182 RAS*RSQLVPDLPARELVPDL 244 + S S V D A+EL D+ Sbjct: 285 KPSPPS--VSD--AKELAKDV 301 >XP_002265804.1 PREDICTED: tubby-like F-box protein 5 [Vitis vinifera] Length = 413 Score = 85.1 bits (209), Expect = 1e-16 Identities = 47/88 (53%), Positives = 56/88 (63%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA*KNFFFTGPKRE 181 V+PRVPA NY ++T SYELNVLRTRGPRRM C MHSIPISSI++GGTA F P E Sbjct: 226 VSPRVPACNYSVATISYELNVLRTRGPRRMQCTMHSIPISSIQEGGTAPTPTSFPQPFDE 285 Query: 182 RAS*RSQLVPDLPARELVPDLPARELVP 265 + S L P ++ + LVP Sbjct: 286 QFSPSPCLRKKDPVTDICSTSLSEPLVP 313 >XP_013444583.1 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] KEH18608.1 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] Length = 1053 Score = 74.7 bits (182), Expect(2) = 1e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+A L TSTLR+EQ+SLTGEAMPVLKGTN IF Sbjct: 163 RVGDKVPADMRVAALKTSTLRLEQSSLTGEAMPVLKGTNPIF 204 Score = 38.5 bits (88), Expect(2) = 1e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 233 VPDLPARELVPGDIVGLRV 289 VPDLPARELVPGDIV LRV Sbjct: 146 VPDLPARELVPGDIVELRV 164 >XP_004306639.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Fragaria vesca subsp. vesca] XP_011468912.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Fragaria vesca subsp. vesca] Length = 1051 Score = 73.2 bits (178), Expect(2) = 1e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPVLK T+ IF Sbjct: 160 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVLKSTDPIF 201 Score = 40.0 bits (92), Expect(2) = 1e-16 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLPARELVPGDIV LRV Sbjct: 142 LVPDLPARELVPGDIVELRV 161 >AAL35972.1 type IIA calcium ATPase [Medicago truncatula] Length = 1047 Score = 74.7 bits (182), Expect(2) = 1e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+A L TSTLR+EQ+SLTGEAMPVLKGTN IF Sbjct: 157 RVGDKVPADMRVAALKTSTLRLEQSSLTGEAMPVLKGTNPIF 198 Score = 38.5 bits (88), Expect(2) = 1e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 233 VPDLPARELVPGDIVGLRV 289 VPDLPARELVPGDIV LRV Sbjct: 140 VPDLPARELVPGDIVELRV 158 >XP_013444582.1 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] KEH18607.1 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] Length = 897 Score = 74.7 bits (182), Expect(2) = 1e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+A L TSTLR+EQ+SLTGEAMPVLKGTN IF Sbjct: 163 RVGDKVPADMRVAALKTSTLRLEQSSLTGEAMPVLKGTNPIF 204 Score = 38.5 bits (88), Expect(2) = 1e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 233 VPDLPARELVPGDIVGLRV 289 VPDLPARELVPGDIV LRV Sbjct: 146 VPDLPARELVPGDIVELRV 164 >XP_003627528.2 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] AET02004.2 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] Length = 774 Score = 74.7 bits (182), Expect(2) = 1e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+A L TSTLR+EQ+SLTGEAMPVLKGTN IF Sbjct: 163 RVGDKVPADMRVAALKTSTLRLEQSSLTGEAMPVLKGTNPIF 204 Score = 38.5 bits (88), Expect(2) = 1e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 233 VPDLPARELVPGDIVGLRV 289 VPDLPARELVPGDIV LRV Sbjct: 146 VPDLPARELVPGDIVELRV 164 >XP_013444584.1 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] KEH18609.1 endoplasmic reticulum-type calcium-transporting ATPase [Medicago truncatula] Length = 756 Score = 74.7 bits (182), Expect(2) = 1e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+A L TSTLR+EQ+SLTGEAMPVLKGTN IF Sbjct: 163 RVGDKVPADMRVAALKTSTLRLEQSSLTGEAMPVLKGTNPIF 204 Score = 38.5 bits (88), Expect(2) = 1e-16 Identities = 18/19 (94%), Positives = 18/19 (94%) Frame = +2 Query: 233 VPDLPARELVPGDIVGLRV 289 VPDLPARELVPGDIV LRV Sbjct: 146 VPDLPARELVPGDIVELRV 164 >XP_011099633.1 PREDICTED: tubby-like F-box protein 5 [Sesamum indicum] Length = 412 Score = 84.7 bits (208), Expect = 1e-16 Identities = 37/48 (77%), Positives = 45/48 (93%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA 145 V+P++PA NY ++T SYELNVLRTRGPRRMHCVMHSIP+SSI++GGTA Sbjct: 225 VSPKLPAFNYTVATISYELNVLRTRGPRRMHCVMHSIPVSSIQEGGTA 272 >CBI17501.3 unnamed protein product, partial [Vitis vinifera] Length = 342 Score = 84.0 bits (206), Expect = 2e-16 Identities = 42/63 (66%), Positives = 48/63 (76%) Frame = +2 Query: 2 VTPRVPASNYCISTASYELNVLRTRGPRRMHCVMHSIPISSIKKGGTA*KNFFFTGPKRE 181 V+PRVPA NY ++T SYELNVLRTRGPRRM C MHSIPISSI++GGTA F P E Sbjct: 226 VSPRVPACNYSVATISYELNVLRTRGPRRMQCTMHSIPISSIQEGGTAPTPTSFPQPFDE 285 Query: 182 RAS 190 + S Sbjct: 286 QFS 288 >XP_008233097.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Prunus mume] XP_008233098.1 PREDICTED: calcium-transporting ATPase, endoplasmic reticulum-type [Prunus mume] Length = 1051 Score = 72.8 bits (177), Expect(2) = 2e-16 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPVLK T IF Sbjct: 160 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVLKSTGPIF 201 Score = 40.0 bits (92), Expect(2) = 2e-16 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLPARELVPGDIV LRV Sbjct: 142 LVPDLPARELVPGDIVELRV 161 >XP_007220597.1 hypothetical protein PRUPE_ppa000654mg [Prunus persica] ONI23531.1 hypothetical protein PRUPE_2G193300 [Prunus persica] ONI23532.1 hypothetical protein PRUPE_2G193300 [Prunus persica] ONI23533.1 hypothetical protein PRUPE_2G193300 [Prunus persica] ONI23534.1 hypothetical protein PRUPE_2G193300 [Prunus persica] ONI23535.1 hypothetical protein PRUPE_2G193300 [Prunus persica] Length = 1051 Score = 72.8 bits (177), Expect(2) = 2e-16 Identities = 36/42 (85%), Positives = 38/42 (90%) Frame = +1 Query: 286 RVGDKVPADMRIAVLNTSTLRVEQNSLTGEAMPVLKGTNTIF 411 RVGDKVPADMR+AVL TSTLRVEQ+SLTGEAMPVLK T IF Sbjct: 160 RVGDKVPADMRVAVLKTSTLRVEQSSLTGEAMPVLKSTGPIF 201 Score = 40.0 bits (92), Expect(2) = 2e-16 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 230 LVPDLPARELVPGDIVGLRV 289 LVPDLPARELVPGDIV LRV Sbjct: 142 LVPDLPARELVPGDIVELRV 161