BLASTX nr result
ID: Panax25_contig00031951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031951 (462 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002270167.1 PREDICTED: uncharacterized protein LOC100240762 [... 55 2e-06 >XP_002270167.1 PREDICTED: uncharacterized protein LOC100240762 [Vitis vinifera] XP_010652078.1 PREDICTED: uncharacterized protein LOC100240762 [Vitis vinifera] XP_019076428.1 PREDICTED: uncharacterized protein LOC100240762 [Vitis vinifera] CBI32273.3 unnamed protein product, partial [Vitis vinifera] Length = 180 Score = 55.1 bits (131), Expect = 2e-06 Identities = 29/50 (58%), Positives = 32/50 (64%) Frame = +1 Query: 292 PINGHSLCLSTPKPHSHSDPQIDGGEEDPEEYVQNLRVPDHWLNTSKALE 441 P+ GH S P+ S SDPQ E D E VQ+LRVPDHWLN SKALE Sbjct: 46 PLKGHLRNRSVPRSQSSSDPQ-SYEEGDEETLVQDLRVPDHWLNPSKALE 94