BLASTX nr result
ID: Panax25_contig00031950
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031950 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019164843.1 PREDICTED: asparagine synthetase domain-containin... 80 8e-15 XP_019164842.1 PREDICTED: asparagine synthetase domain-containin... 80 8e-15 XP_010649866.1 PREDICTED: asparagine synthetase domain-containin... 77 9e-14 XP_012847760.1 PREDICTED: asparagine synthetase domain-containin... 76 1e-13 XP_012847759.1 PREDICTED: asparagine synthetase domain-containin... 76 1e-13 EYU28871.1 hypothetical protein MIMGU_mgv1a002623mg [Erythranthe... 76 1e-13 XP_011101761.1 PREDICTED: asparagine synthetase domain-containin... 76 1e-13 XP_020096662.1 asparagine synthetase domain-containing protein 1... 76 1e-13 XP_020096661.1 asparagine synthetase domain-containing protein 1... 76 1e-13 OAY70252.1 Asparagine synthetase domain-containing protein 1 [An... 76 1e-13 XP_010923628.1 PREDICTED: asparagine synthetase domain-containin... 75 3e-13 XP_002443410.1 hypothetical protein SORBIDRAFT_08g019070 [Sorghu... 70 4e-13 XP_019252451.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_016435481.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_016435480.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_018732838.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_016435478.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_019252449.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_016451119.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 XP_009800177.1 PREDICTED: asparagine synthetase domain-containin... 75 4e-13 >XP_019164843.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X2 [Ipomoea nil] Length = 658 Score = 79.7 bits (195), Expect = 8e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP*N 128 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY P N Sbjct: 617 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYGPSN 658 >XP_019164842.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X1 [Ipomoea nil] Length = 660 Score = 79.7 bits (195), Expect = 8e-15 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP*N 128 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY P N Sbjct: 619 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYGPSN 660 >XP_010649866.1 PREDICTED: asparagine synthetase domain-containing protein 1 [Vitis vinifera] CBI27298.3 unnamed protein product, partial [Vitis vinifera] Length = 645 Score = 76.6 bits (187), Expect = 9e-14 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP*N 128 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY N Sbjct: 602 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYGTSN 643 >XP_012847760.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X2 [Erythranthe guttata] Length = 602 Score = 76.3 bits (186), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY Sbjct: 561 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 598 >XP_012847759.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X1 [Erythranthe guttata] Length = 643 Score = 76.3 bits (186), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY Sbjct: 602 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 639 >EYU28871.1 hypothetical protein MIMGU_mgv1a002623mg [Erythranthe guttata] Length = 653 Score = 76.3 bits (186), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY Sbjct: 612 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 649 >XP_011101761.1 PREDICTED: asparagine synthetase domain-containing protein 1 [Sesamum indicum] Length = 654 Score = 76.3 bits (186), Expect = 1e-13 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY Sbjct: 613 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 650 >XP_020096662.1 asparagine synthetase domain-containing protein 1 isoform X2 [Ananas comosus] Length = 696 Score = 76.3 bits (186), Expect = 1e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP*N 128 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVI P N Sbjct: 649 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIRQPQN 690 >XP_020096661.1 asparagine synthetase domain-containing protein 1 isoform X1 [Ananas comosus] Length = 706 Score = 76.3 bits (186), Expect = 1e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP*N 128 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVI P N Sbjct: 659 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIRQPQN 700 >OAY70252.1 Asparagine synthetase domain-containing protein 1 [Ananas comosus] Length = 712 Score = 76.3 bits (186), Expect = 1e-13 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP*N 128 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVI P N Sbjct: 665 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIRQPQN 706 >XP_010923628.1 PREDICTED: asparagine synthetase domain-containing protein 1-like [Elaeis guineensis] Length = 369 Score = 74.7 bits (182), Expect = 3e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP 122 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV I+ P Sbjct: 328 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVKIHQP 367 >XP_002443410.1 hypothetical protein SORBIDRAFT_08g019070 [Sorghum bicolor] Length = 119 Score = 70.5 bits (171), Expect = 4e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +3 Query: 6 PKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 PKRAIQFGSRIARESNRKNFGSNRAANQASAGSV I+ Sbjct: 79 PKRAIQFGSRIARESNRKNFGSNRAANQASAGSVQIH 115 >XP_019252451.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X3 [Nicotiana attenuata] Length = 571 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 530 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 567 >XP_016435481.1 PREDICTED: asparagine synthetase domain-containing protein 1-like isoform X5 [Nicotiana tabacum] Length = 572 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 531 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 568 >XP_016435480.1 PREDICTED: asparagine synthetase domain-containing protein 1-like isoform X4 [Nicotiana tabacum] Length = 622 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 581 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 618 >XP_018732838.1 PREDICTED: asparagine synthetase domain-containing protein 1 [Eucalyptus grandis] Length = 644 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIYNP 122 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV I+ P Sbjct: 605 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIHMP 644 >XP_016435478.1 PREDICTED: asparagine synthetase domain-containing protein 1-like isoform X2 [Nicotiana tabacum] Length = 648 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 607 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 644 >XP_019252449.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X1 [Nicotiana attenuata] OIS99704.1 hypothetical protein A4A49_05551 [Nicotiana attenuata] Length = 661 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 620 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 657 >XP_016451119.1 PREDICTED: asparagine synthetase domain-containing protein 1-like isoform X1 [Nicotiana tabacum] Length = 661 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 620 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 657 >XP_009800177.1 PREDICTED: asparagine synthetase domain-containing protein 1 isoform X1 [Nicotiana sylvestris] Length = 661 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/38 (97%), Positives = 37/38 (97%) Frame = +3 Query: 3 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVVIY 116 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSV IY Sbjct: 620 LPKRAIQFGSRIARESNRKNFGSNRAANQASAGSVTIY 657