BLASTX nr result
ID: Panax25_contig00031830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031830 (385 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017242694.1 PREDICTED: zinc finger CCCH domain-containing pro... 79 1e-14 >XP_017242694.1 PREDICTED: zinc finger CCCH domain-containing protein 41 [Daucus carota subsp. sativus] XP_017242695.1 PREDICTED: zinc finger CCCH domain-containing protein 41 [Daucus carota subsp. sativus] KZN02494.1 hypothetical protein DCAR_011248 [Daucus carota subsp. sativus] Length = 919 Score = 79.0 bits (193), Expect = 1e-14 Identities = 46/87 (52%), Positives = 55/87 (63%) Frame = -3 Query: 383 QFIWLTPSNSTKDNVGRENPXXXXXXXXSDANCQATGEVASTVSHKTSMSGDRESEVLER 204 QFIWLT SNS K++ GRENP DAN Q GE A VS K MSGD ESE ER Sbjct: 831 QFIWLTSSNSGKEDTGRENPSSPTKGSS-DANGQPVGEGALLVSQKKPMSGDEESENSER 889 Query: 203 RDGGAEPIMPDAEINSSLTAMSSKKQS 123 RD ++ + D E++SSLT +S +KQS Sbjct: 890 RDKSSDHLGADDEMHSSLTPVSLEKQS 916