BLASTX nr result
ID: Panax25_contig00031828
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031828 (629 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009338673.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 5e-06 >XP_009338673.1 PREDICTED: pentatricopeptide repeat-containing protein At5g39710-like [Pyrus x bretschneideri] Length = 710 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +2 Query: 32 SPLLAELMQLLETRRIDWISLLDRLKEQNTGLYFK 136 SPLLAE ++LL+ R+DW++LLDRLKEQNT LYFK Sbjct: 325 SPLLAEWIELLQPSRVDWLNLLDRLKEQNTALYFK 359