BLASTX nr result
ID: Panax25_contig00031813
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031813 (532 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017252896.1 PREDICTED: mannosyl-oligosaccharide 1,2-alpha-man... 61 8e-08 KZM92838.1 hypothetical protein DCAR_016083 [Daucus carota subsp... 61 8e-08 XP_017252893.1 PREDICTED: mannosyl-oligosaccharide 1,2-alpha-man... 61 8e-08 >XP_017252896.1 PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1-like isoform X2 [Daucus carota subsp. sativus] Length = 463 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -1 Query: 532 FNTEAHPIRIVTRHGLGDDSET-DEQHKLKLRARKEGRFGN 413 FNTEAHP+RIVTRHG G +E DEQHK KL ARK+GRFG+ Sbjct: 422 FNTEAHPLRIVTRHGQGVINEVLDEQHKPKLHARKQGRFGH 462 >KZM92838.1 hypothetical protein DCAR_016083 [Daucus carota subsp. sativus] Length = 562 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -1 Query: 532 FNTEAHPIRIVTRHGLGDDSET-DEQHKLKLRARKEGRFGN 413 FNTEAHP+RIVTRHG G +E DEQHK KL ARK+GRFG+ Sbjct: 521 FNTEAHPLRIVTRHGQGVINEVLDEQHKPKLHARKQGRFGH 561 >XP_017252893.1 PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1-like isoform X1 [Daucus carota subsp. sativus] XP_017252895.1 PREDICTED: mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1-like isoform X1 [Daucus carota subsp. sativus] Length = 578 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/41 (73%), Positives = 34/41 (82%), Gaps = 1/41 (2%) Frame = -1 Query: 532 FNTEAHPIRIVTRHGLGDDSET-DEQHKLKLRARKEGRFGN 413 FNTEAHP+RIVTRHG G +E DEQHK KL ARK+GRFG+ Sbjct: 537 FNTEAHPLRIVTRHGQGVINEVLDEQHKPKLHARKQGRFGH 577