BLASTX nr result
ID: Panax25_contig00031734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031734 (372 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN09126.1 hypothetical protein DCAR_001782 [Daucus carota subsp... 67 1e-11 KZM98414.1 hypothetical protein DCAR_014224 [Daucus carota subsp... 67 3e-11 XP_017245012.1 PREDICTED: uncharacterized protein LOC108216694 i... 67 3e-11 XP_017250578.1 PREDICTED: uncharacterized protein LOC108221158 [... 67 3e-11 XP_017245011.1 PREDICTED: uncharacterized protein LOC108216694 i... 67 3e-11 >KZN09126.1 hypothetical protein DCAR_001782 [Daucus carota subsp. sativus] Length = 146 Score = 67.0 bits (162), Expect = 1e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 21 IEEDKKSLNKPSKSSFVEGDEAKKKAYWLDGNAKPE 128 IEEDKK+LNK SKSSFVEGDEAKKK++WL+GN KPE Sbjct: 65 IEEDKKNLNKQSKSSFVEGDEAKKKSHWLEGNGKPE 100 >KZM98414.1 hypothetical protein DCAR_014224 [Daucus carota subsp. sativus] Length = 185 Score = 67.0 bits (162), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 21 IEEDKKSLNKPSKSSFVEGDEAKKKAYWLDGNAKPE 128 IEEDKK+LNK SKSSFVEGDEAKKK++WL+GN KPE Sbjct: 104 IEEDKKNLNKQSKSSFVEGDEAKKKSHWLEGNGKPE 139 >XP_017245012.1 PREDICTED: uncharacterized protein LOC108216694 isoform X2 [Daucus carota subsp. sativus] Length = 186 Score = 67.0 bits (162), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 21 IEEDKKSLNKPSKSSFVEGDEAKKKAYWLDGNAKPE 128 IEEDKK+LNK SKSSFVEGDEAKKK++WL+GN KPE Sbjct: 104 IEEDKKNLNKQSKSSFVEGDEAKKKSHWLEGNGKPE 139 >XP_017250578.1 PREDICTED: uncharacterized protein LOC108221158 [Daucus carota subsp. sativus] Length = 190 Score = 67.0 bits (162), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 21 IEEDKKSLNKPSKSSFVEGDEAKKKAYWLDGNAKPE 128 IEEDKK+LNK SKSSFVEGDEAKKK++WL+GN KPE Sbjct: 104 IEEDKKNLNKQSKSSFVEGDEAKKKSHWLEGNGKPE 139 >XP_017245011.1 PREDICTED: uncharacterized protein LOC108216694 isoform X1 [Daucus carota subsp. sativus] Length = 199 Score = 67.0 bits (162), Expect = 3e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 21 IEEDKKSLNKPSKSSFVEGDEAKKKAYWLDGNAKPE 128 IEEDKK+LNK SKSSFVEGDEAKKK++WL+GN KPE Sbjct: 104 IEEDKKNLNKQSKSSFVEGDEAKKKSHWLEGNGKPE 139