BLASTX nr result
ID: Panax25_contig00031638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031638 (1762 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016684299.1 PREDICTED: inositol transporter 4-like [Gossypium... 77 2e-12 XP_007026283.1 PREDICTED: inositol transporter 4 [Theobroma caca... 77 3e-11 XP_017602770.1 PREDICTED: inositol transporter 4-like [Gossypium... 77 5e-11 XP_017985141.1 PREDICTED: inositol transporter 4 isoform X1 [The... 77 5e-11 XP_007009122.2 PREDICTED: inositol transporter 4 isoform X2 [The... 76 6e-11 EOY17932.1 Inositol transporter 4 isoform 1 [Theobroma cacao] 76 6e-11 EOY17934.1 Inositol transporter 4 isoform 3 [Theobroma cacao] 76 6e-11 XP_018470857.1 PREDICTED: inositol transporter 4 [Raphanus sativ... 76 9e-11 XP_013688201.1 PREDICTED: inositol transporter 4-like [Brassica ... 76 9e-11 XP_013743494.1 PREDICTED: inositol transporter 4-like [Brassica ... 76 9e-11 XP_013601448.1 PREDICTED: inositol transporter 4 [Brassica olera... 76 9e-11 XP_009145854.1 PREDICTED: inositol transporter 4-like [Brassica ... 76 9e-11 XP_006414343.1 hypothetical protein EUTSA_v10024765mg [Eutrema s... 76 9e-11 NP_193381.1 inositol transporter 4 [Arabidopsis thaliana] NP_001... 76 9e-11 XP_010449779.1 PREDICTED: inositol transporter 4-like [Camelina ... 76 9e-11 XP_010440148.1 PREDICTED: inositol transporter 4-like [Camelina ... 76 9e-11 XP_010434813.1 PREDICTED: inositol transporter 4 [Camelina sativ... 76 9e-11 XP_006282574.1 hypothetical protein CARUB_v10004447mg [Capsella ... 76 9e-11 XP_002870155.1 ATINT4 [Arabidopsis lyrata subsp. lyrata] EFH4641... 76 9e-11 JAU55085.1 Inositol transporter 4 [Noccaea caerulescens] JAU9533... 76 9e-11 >XP_016684299.1 PREDICTED: inositol transporter 4-like [Gossypium hirsutum] Length = 207 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIMKLALSAGIGGLLFG+ Sbjct: 1 MVEGGVAKADKTEFTECWRTTWKTPYIMKLALSAGIGGLLFGY 43 >XP_007026283.1 PREDICTED: inositol transporter 4 [Theobroma cacao] XP_017979175.1 PREDICTED: inositol transporter 4 [Theobroma cacao] EOY28905.1 Inositol transporter 4 [Theobroma cacao] Length = 576 Score = 77.4 bits (189), Expect = 3e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIMKLALSAGIGGLLFG+ Sbjct: 1 MVEGGVTKADKTEFTECWKTTWKTPYIMKLALSAGIGGLLFGY 43 >XP_017602770.1 PREDICTED: inositol transporter 4-like [Gossypium arboreum] Length = 572 Score = 76.6 bits (187), Expect = 5e-11 Identities = 34/43 (79%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIMKLALSAGIGGLLFG+ Sbjct: 1 MVEGGVAKADKTEFTECWRTTWKTPYIMKLALSAGIGGLLFGY 43 >XP_017985141.1 PREDICTED: inositol transporter 4 isoform X1 [Theobroma cacao] XP_017985142.1 PREDICTED: inositol transporter 4 isoform X1 [Theobroma cacao] XP_017985143.1 PREDICTED: inositol transporter 4 isoform X1 [Theobroma cacao] Length = 592 Score = 76.6 bits (187), Expect = 5e-11 Identities = 33/44 (75%), Positives = 40/44 (90%) Frame = +2 Query: 8 EMVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 +MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 17 KMVEGGVKKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 60 >XP_007009122.2 PREDICTED: inositol transporter 4 isoform X2 [Theobroma cacao] Length = 575 Score = 76.3 bits (186), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGVKKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >EOY17932.1 Inositol transporter 4 isoform 1 [Theobroma cacao] Length = 575 Score = 76.3 bits (186), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGVKKADKTEFTECWKTTWKTPYIMRLALSAGIGGLLFGY 43 >EOY17934.1 Inositol transporter 4 isoform 3 [Theobroma cacao] Length = 576 Score = 76.3 bits (186), Expect = 6e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGVKKADKTEFTECWKTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_018470857.1 PREDICTED: inositol transporter 4 [Raphanus sativus] XP_018470858.1 PREDICTED: inositol transporter 4 [Raphanus sativus] XP_018470861.1 PREDICTED: inositol transporter 4 [Raphanus sativus] XP_018470869.1 PREDICTED: inositol transporter 4 [Raphanus sativus] XP_018470870.1 PREDICTED: inositol transporter 4 [Raphanus sativus] XP_018470871.1 PREDICTED: inositol transporter 4 [Raphanus sativus] Length = 581 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_013688201.1 PREDICTED: inositol transporter 4-like [Brassica napus] XP_013688202.1 PREDICTED: inositol transporter 4-like [Brassica napus] Length = 581 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_013743494.1 PREDICTED: inositol transporter 4-like [Brassica napus] XP_013743502.1 PREDICTED: inositol transporter 4-like [Brassica napus] Length = 581 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_013601448.1 PREDICTED: inositol transporter 4 [Brassica oleracea var. oleracea] XP_013601454.1 PREDICTED: inositol transporter 4 [Brassica oleracea var. oleracea] XP_013601457.1 PREDICTED: inositol transporter 4 [Brassica oleracea var. oleracea] Length = 581 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_009145854.1 PREDICTED: inositol transporter 4-like [Brassica rapa] Length = 581 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_006414343.1 hypothetical protein EUTSA_v10024765mg [Eutrema salsugineum] ESQ55796.1 hypothetical protein EUTSA_v10024765mg [Eutrema salsugineum] Length = 581 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >NP_193381.1 inositol transporter 4 [Arabidopsis thaliana] NP_001328028.1 inositol transporter 4 [Arabidopsis thaliana] NP_001328029.1 inositol transporter 4 [Arabidopsis thaliana] O23492.1 RecName: Full=Inositol transporter 4; AltName: Full=Myo-inositol-proton symporter INT4; AltName: Full=Protein INOSITOL TRANSPORTER 4 CAB10424.1 membrane transporter like protein [Arabidopsis thaliana] CAB78690.1 membrane transporter like protein [Arabidopsis thaliana] AAO42160.1 putative membrane transporter [Arabidopsis thaliana] AAO64127.1 putative membrane transporter [Arabidopsis thaliana] CAJ00306.1 inositol transporter 4 [Arabidopsis thaliana] AEE83759.1 inositol transporter 4 [Arabidopsis thaliana] OAP00727.1 INT4 [Arabidopsis thaliana] ANM66112.1 inositol transporter 4 [Arabidopsis thaliana] ANM66113.1 inositol transporter 4 [Arabidopsis thaliana] Length = 582 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_010449779.1 PREDICTED: inositol transporter 4-like [Camelina sativa] XP_010449780.1 PREDICTED: inositol transporter 4-like [Camelina sativa] Length = 582 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_010440148.1 PREDICTED: inositol transporter 4-like [Camelina sativa] Length = 582 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_010434813.1 PREDICTED: inositol transporter 4 [Camelina sativa] XP_010434814.1 PREDICTED: inositol transporter 4 [Camelina sativa] XP_010434815.1 PREDICTED: inositol transporter 4 [Camelina sativa] Length = 582 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_006282574.1 hypothetical protein CARUB_v10004447mg [Capsella rubella] EOA15472.1 hypothetical protein CARUB_v10004447mg [Capsella rubella] Length = 582 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >XP_002870155.1 ATINT4 [Arabidopsis lyrata subsp. lyrata] EFH46414.1 ATINT4 [Arabidopsis lyrata subsp. lyrata] Length = 582 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43 >JAU55085.1 Inositol transporter 4 [Noccaea caerulescens] JAU95336.1 Inositol transporter 4 [Noccaea caerulescens] Length = 583 Score = 75.9 bits (185), Expect = 9e-11 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = +2 Query: 11 MVEAELNKADKTKLTKCWQTTWKTPYIMKLALSAGIGGLLFGW 139 MVE + KADKT+ T+CW+TTWKTPYIM+LALSAGIGGLLFG+ Sbjct: 1 MVEGGIAKADKTEFTECWRTTWKTPYIMRLALSAGIGGLLFGY 43