BLASTX nr result
ID: Panax25_contig00031610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031610 (818 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015080607.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 70 3e-10 XP_004243698.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 70 3e-10 XP_018836277.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 69 3e-10 CBI27781.3 unnamed protein product, partial [Vitis vinifera] 68 5e-10 XP_018814733.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 69 9e-10 XP_006367435.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 69 9e-10 XP_019194242.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 69 9e-10 CDP03057.1 unnamed protein product [Coffea canephora] 69 9e-10 XP_017219839.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 68 1e-09 XP_004307067.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 68 1e-09 XP_002277343.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 68 1e-09 XP_010260199.1 PREDICTED: uncharacterized protein LOC104599387 [... 65 2e-09 XP_019196210.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 66 2e-09 OAY76434.1 Ubiquinone biosynthesis protein COQ9, mitochondrial [... 67 2e-09 XP_020092823.1 ubiquinone biosynthesis protein COQ9, mitochondri... 67 2e-09 GAV64764.1 COQ9 domain-containing protein [Cephalotus follicularis] 67 3e-09 XP_011093840.1 PREDICTED: ubiquinone biosynthesis protein COQ9, ... 67 3e-09 XP_019249194.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 67 3e-09 XP_009771857.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 67 3e-09 XP_017643702.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B... 67 4e-09 >XP_015080607.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Solanum pennellii] Length = 309 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 LSHV RLGWTE AMIAGAR+VGVSPSIVGSFP+KEAALVE Sbjct: 108 LSHVLRLGWTETAMIAGARDVGVSPSIVGSFPRKEAALVE 147 >XP_004243698.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Solanum lycopersicum] Length = 309 Score = 70.1 bits (170), Expect = 3e-10 Identities = 36/40 (90%), Positives = 38/40 (95%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 LSHV RLGWTE AMIAGAR+VGVSPSIVGSFP+KEAALVE Sbjct: 108 LSHVIRLGWTETAMIAGARDVGVSPSIVGSFPRKEAALVE 147 >XP_018836277.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Juglans regia] Length = 211 Score = 68.6 bits (166), Expect = 3e-10 Identities = 36/52 (69%), Positives = 42/52 (80%), Gaps = 2/52 (3%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE--AKFCLSSVVCKEEL 727 VRLGWTEAAMI+GAR VGVSPSI+GSFP+KEAALVE CL ++ + EL Sbjct: 101 VRLGWTEAAMISGARAVGVSPSIIGSFPRKEAALVEFFMDECLQRLIDRIEL 152 >CBI27781.3 unnamed protein product, partial [Vitis vinifera] Length = 227 Score = 68.2 bits (165), Expect = 5e-10 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 L HV RLGWTE AMIAGAREVGVSPSIVGSFP++EAALVE Sbjct: 21 LHHVARLGWTETAMIAGAREVGVSPSIVGSFPRREAALVE 60 >XP_018814733.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Juglans regia] Length = 301 Score = 68.6 bits (166), Expect = 9e-10 Identities = 36/52 (69%), Positives = 42/52 (80%), Gaps = 2/52 (3%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE--AKFCLSSVVCKEEL 727 VRLGWTEAAMI+GAR VGVSPSI+GSFP+KEAALVE CL ++ + EL Sbjct: 104 VRLGWTEAAMISGARAVGVSPSIIGSFPRKEAALVEFFMDECLQRLIDRIEL 155 >XP_006367435.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Solanum tuberosum] Length = 304 Score = 68.6 bits (166), Expect = 9e-10 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 LSHV RLGWTE AMI GAR+VGVSPSIVGSFP+KEAALVE Sbjct: 103 LSHVLRLGWTETAMITGARDVGVSPSIVGSFPRKEAALVE 142 >XP_019194242.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like [Ipomoea nil] Length = 306 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 ++LGWTEAAMIAGAREVG+SPSIVGSFP+KEAALVE Sbjct: 109 IKLGWTEAAMIAGAREVGLSPSIVGSFPRKEAALVE 144 >CDP03057.1 unnamed protein product [Coffea canephora] Length = 312 Score = 68.6 bits (166), Expect = 9e-10 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 +RLGWTEAA+IAGAREVGVSPSIVGSFP+K+AALVE Sbjct: 112 IRLGWTEAALIAGAREVGVSPSIVGSFPRKDAALVE 147 >XP_017219839.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Daucus carota subsp. sativus] KZM87664.1 hypothetical protein DCAR_024765 [Daucus carota subsp. sativus] Length = 287 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/40 (85%), Positives = 38/40 (95%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 L HV RLGWTEAAM+AGAR+VGVSPSIVG+FP+KEAALVE Sbjct: 86 LRHVPRLGWTEAAMVAGARDVGVSPSIVGAFPRKEAALVE 125 >XP_004307067.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Fragaria vesca subsp. vesca] Length = 288 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/36 (88%), Positives = 36/36 (100%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 +RLGW+EAAMIAGAR+VGVSPSIVGSFP+KEAALVE Sbjct: 90 IRLGWSEAAMIAGARDVGVSPSIVGSFPRKEAALVE 125 >XP_002277343.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Vitis vinifera] Length = 318 Score = 68.2 bits (165), Expect = 1e-09 Identities = 35/40 (87%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 L HV RLGWTE AMIAGAREVGVSPSIVGSFP++EAALVE Sbjct: 112 LHHVARLGWTETAMIAGAREVGVSPSIVGSFPRREAALVE 151 >XP_010260199.1 PREDICTED: uncharacterized protein LOC104599387 [Nelumbo nucifera] XP_010260200.1 PREDICTED: uncharacterized protein LOC104599387 [Nelumbo nucifera] XP_019053682.1 PREDICTED: uncharacterized protein LOC104599387 [Nelumbo nucifera] Length = 150 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 VRLGWTE AMI GAR+VG+SPSI+GSFP+KEAALVE Sbjct: 108 VRLGWTETAMIKGARDVGLSPSIIGSFPRKEAALVE 143 >XP_019196210.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial-like isoform X2 [Ipomoea nil] Length = 205 Score = 66.2 bits (160), Expect = 2e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 +RLGWTEAAMIAGAR+VGVSPSIVGSF KEAALVE Sbjct: 8 IRLGWTEAAMIAGARDVGVSPSIVGSFASKEAALVE 43 >OAY76434.1 Ubiquinone biosynthesis protein COQ9, mitochondrial [Ananas comosus] Length = 287 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 5/50 (10%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVEA-----KFCLSSVV 712 VRLGW+E+AMIAGAR+VGVSPSIVG+FP+KEAALVE +CL +V Sbjct: 97 VRLGWSESAMIAGARDVGVSPSIVGTFPRKEAALVEVINFFMDYCLERLV 146 >XP_020092823.1 ubiquinone biosynthesis protein COQ9, mitochondrial-like isoform X2 [Ananas comosus] Length = 299 Score = 67.4 bits (163), Expect = 2e-09 Identities = 34/50 (68%), Positives = 41/50 (82%), Gaps = 5/50 (10%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVEA-----KFCLSSVV 712 VRLGW+E+AMIAGAR+VGVSPSIVG+FP+KEAALVE +CL +V Sbjct: 97 VRLGWSESAMIAGARDVGVSPSIVGTFPRKEAALVEVINFFMDYCLERLV 146 >GAV64764.1 COQ9 domain-containing protein [Cephalotus follicularis] Length = 292 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/36 (86%), Positives = 36/36 (100%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 +RLGW+EAAMIAGAR+VGVSPSIVGSFP+K+AALVE Sbjct: 95 IRLGWSEAAMIAGARDVGVSPSIVGSFPRKDAALVE 130 >XP_011093840.1 PREDICTED: ubiquinone biosynthesis protein COQ9, mitochondrial [Sesamum indicum] Length = 293 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +2 Query: 578 VRLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 +RLGW EA+MIAGAREVGVSPSIVGSFP+KEAALVE Sbjct: 96 IRLGWGEASMIAGAREVGVSPSIVGSFPRKEAALVE 131 >XP_019249194.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Nicotiana attenuata] OIS99937.1 hypothetical protein A4A49_17243 [Nicotiana attenuata] Length = 310 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 L HV RLGWTE AMI+GAR+VGVSPSIVGSFP+KEAALVE Sbjct: 109 LPHVLRLGWTETAMISGARDVGVSPSIVGSFPRKEAALVE 148 >XP_009771857.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial [Nicotiana sylvestris] XP_016455299.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial-like [Nicotiana tabacum] Length = 310 Score = 67.0 bits (162), Expect = 3e-09 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVE 685 L HV RLGWTE AMI+GAR+VGVSPSIVGSFP+KEAALVE Sbjct: 109 LPHVLRLGWTETAMISGARDVGVSPSIVGSFPRKEAALVE 148 >XP_017643702.1 PREDICTED: ubiquinone biosynthesis protein COQ9-B, mitochondrial-like isoform X1 [Gossypium arboreum] Length = 306 Score = 66.6 bits (161), Expect = 4e-09 Identities = 34/46 (73%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 569 LSHV-RLGWTEAAMIAGAREVGVSPSIVGSFPQKEAALVEAKFCLS 703 L HV RLGW+E AMIAGA+E G+SPSIVGSFP+KEAALVE F L+ Sbjct: 98 LRHVLRLGWSEEAMIAGAKEAGISPSIVGSFPRKEAALVEVLFGLN 143