BLASTX nr result
ID: Panax25_contig00031606
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031606 (714 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONM35692.1 60S ribosomal protein L5-1 homolog a [Zea mays] 54 4e-06 >ONM35692.1 60S ribosomal protein L5-1 homolog a [Zea mays] Length = 92 Score = 53.9 bits (128), Expect = 4e-06 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 5/37 (13%) Frame = -1 Query: 249 GKTDYRARIRLINQDKN-----KYRFVVRFVSTSLFI 154 GKTDYRARIRLINQDKN KYRFVVRFVS FI Sbjct: 27 GKTDYRARIRLINQDKNKYNTPKYRFVVRFVSFDSFI 63