BLASTX nr result
ID: Panax25_contig00031596
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031596 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007222773.1 hypothetical protein PRUPE_ppa006561mg [Prunus pe... 55 4e-06 >XP_007222773.1 hypothetical protein PRUPE_ppa006561mg [Prunus persica] Length = 405 Score = 55.1 bits (131), Expect = 4e-06 Identities = 24/32 (75%), Positives = 29/32 (90%) Frame = -2 Query: 119 EATPKSWIRVMGIHGLTMYHLKSHLQAFLFLY 24 +ATPKS +RVMGIHGLT+YHLKSHLQA+ L+ Sbjct: 35 KATPKSLMRVMGIHGLTLYHLKSHLQAYFSLF 66