BLASTX nr result
ID: Panax25_contig00031583
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031583 (430 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017228624.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 2e-08 >XP_017228624.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228629.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228637.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228640.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228644.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228650.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] XP_017228655.1 PREDICTED: pentatricopeptide repeat-containing protein At5g41170, mitochondrial [Daucus carota subsp. sativus] Length = 826 Score = 62.0 bits (149), Expect = 2e-08 Identities = 30/63 (47%), Positives = 40/63 (63%) Frame = +1 Query: 163 CSENNLIRPIACNGLSVYFSSWSSQNPNHNSHLNPNVCAQLVEKDIFDEGDNGCVRVKET 342 C E++LI P C G+ YFS+ S +N +S + NVCAQLV+KD FD G +G V V+ Sbjct: 25 CCESSLISPFHCEGVCAYFSTNSWRNSCESSRFDANVCAQLVDKDDFDGGGDGSVEVENL 84 Query: 343 GER 351 G R Sbjct: 85 GGR 87