BLASTX nr result
ID: Panax25_contig00031508
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031508 (570 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007046988.2 PREDICTED: pentatricopeptide repeat-containing pr... 67 7e-10 EOX91145.1 Tetratricopeptide repeat (TPR)-like superfamily prote... 67 7e-10 OMO56867.1 hypothetical protein CCACVL1_26203 [Corchorus capsula... 66 2e-09 OMO84333.1 hypothetical protein COLO4_22110 [Corchorus olitorius] 63 2e-08 XP_010437321.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 5e-08 XP_010432150.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 5e-08 XP_006282615.1 hypothetical protein CARUB_v10004839mg, partial [... 61 1e-07 XP_012436918.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-07 XP_016735240.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-07 XP_006411973.1 hypothetical protein EUTSA_v10027579mg [Eutrema s... 60 2e-07 XP_017637318.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-07 XP_016713059.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 3e-07 NP_195386.1 Tetratricopeptide repeat (TPR)-like superfamily prot... 59 4e-07 XP_010446761.1 PREDICTED: pentatricopeptide repeat-containing pr... 59 4e-07 CAA05629.1 membrane-associated salt-inducible protein like, part... 59 4e-07 XP_006410778.1 hypothetical protein EUTSA_v10017741mg, partial [... 59 6e-07 XP_002866998.1 pentatricopeptide repeat-containing protein [Arab... 59 8e-07 KDO79503.1 hypothetical protein CISIN_1g015673mg [Citrus sinensis] 58 1e-06 XP_006425713.1 hypothetical protein CICLE_v10025762mg [Citrus cl... 58 1e-06 XP_009109332.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 1e-06 >XP_007046988.2 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Theobroma cacao] Length = 411 Score = 67.4 bits (163), Expect = 7e-10 Identities = 31/45 (68%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANS--GDVQEAR 440 K+AKGLIRT KKKFPP+FLN+W+K+EEE GLVS N+ G+ QEA+ Sbjct: 363 KEAKGLIRTVKKKFPPNFLNAWKKLEEELGLVSGNAGGGEAQEAK 407 >EOX91145.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Theobroma cacao] Length = 411 Score = 67.4 bits (163), Expect = 7e-10 Identities = 31/45 (68%), Positives = 39/45 (86%), Gaps = 2/45 (4%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANS--GDVQEAR 440 K+AKGLIRT KKKFPP+FLN+W+K+EEE GLVS N+ G+ QEA+ Sbjct: 363 KEAKGLIRTVKKKFPPNFLNAWKKLEEELGLVSGNAGGGEAQEAK 407 >OMO56867.1 hypothetical protein CCACVL1_26203 [Corchorus capsularis] Length = 409 Score = 65.9 bits (159), Expect = 2e-09 Identities = 30/45 (66%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSAN--SGDVQEAR 440 KDAKGLIRT KK FPP+FLN+W+K+EEE GLVS N +G+ Q+A+ Sbjct: 361 KDAKGLIRTVKKTFPPNFLNAWQKLEEELGLVSGNAAAGEAQQAK 405 >OMO84333.1 hypothetical protein COLO4_22110 [Corchorus olitorius] Length = 409 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/45 (64%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS--ANSGDVQEAR 440 KDAKGLIRT KK FPP+FLN+W+K+E+E GLVS A +G+ Q+A+ Sbjct: 361 KDAKGLIRTVKKTFPPNFLNAWQKLEQELGLVSGDAAAGEAQQAK 405 >XP_010437321.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Camelina sativa] Length = 412 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEA 443 DAKGLIRT KKKFPPSF+N+W+K+EEE GL S +EA Sbjct: 370 DAKGLIRTVKKKFPPSFMNAWKKLEEELGLYSKTDASAKEA 410 >XP_010432150.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Camelina sativa] Length = 412 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEA 443 DAKGLIRT KKKFPPSF+N+W+K+EEE GL S +EA Sbjct: 370 DAKGLIRTVKKKFPPSFMNAWKKLEEELGLYSKTDASAKEA 410 >XP_006282615.1 hypothetical protein CARUB_v10004839mg, partial [Capsella rubella] EOA15513.1 hypothetical protein CARUB_v10004839mg, partial [Capsella rubella] Length = 435 Score = 61.2 bits (147), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEA 443 DAKGLIRT KKKFPPSF+N+W+K+EEE GL S +EA Sbjct: 393 DAKGLIRTVKKKFPPSFMNAWKKLEEELGLDSKTDASAKEA 433 >XP_012436918.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium raimondii] KJB48422.1 hypothetical protein B456_008G068700 [Gossypium raimondii] Length = 408 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEAR 440 KDAKGLIRT KK FPP+FL +W+K+EEE GLVS N+ + +EA+ Sbjct: 363 KDAKGLIRTVKKTFPPNFLKAWKKLEEELGLVSGNA-EAREAK 404 >XP_016735240.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Gossypium hirsutum] Length = 409 Score = 60.8 bits (146), Expect = 1e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEAR 440 KDAKGLIRT KK FPP+FL +W+K+EEE GLVS N+ + +EA+ Sbjct: 364 KDAKGLIRTVKKTFPPNFLKAWKKLEEELGLVSGNA-EAREAK 405 >XP_006411973.1 hypothetical protein EUTSA_v10027579mg [Eutrema salsugineum] ESQ53426.1 hypothetical protein EUTSA_v10027579mg [Eutrema salsugineum] Length = 410 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEA 443 DAKGLIRT KKKFPPSFLN+W+K+EEE GL+S A Sbjct: 370 DAKGLIRTVKKKFPPSFLNAWKKLEEEVGLLSKTDASSSSA 410 >XP_017637318.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Gossypium arboreum] Length = 409 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEAR 440 KDAKGLIRT KK FPP+FL +W+K+EEE GLVS N+ + +EA+ Sbjct: 364 KDAKGLIRTVKKTFPPNFLIAWKKLEEELGLVSGNA-EAREAK 405 >XP_016713059.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Gossypium hirsutum] Length = 413 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/43 (65%), Positives = 36/43 (83%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEAR 440 KDAKGLIRT KK FPP+FL +W+K+EEE GLVS N+ + +EA+ Sbjct: 368 KDAKGLIRTVKKTFPPNFLIAWKKLEEELGLVSGNA-EAREAK 409 >NP_195386.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] Q9M065.1 RecName: Full=Pentatricopeptide repeat-containing protein At4g36680, mitochondrial; Flags: Precursor CAB16807.1 salt-inducible like protein [Arabidopsis thaliana] CAB80334.1 salt-inducible like protein [Arabidopsis thaliana] AAL36061.1 C7A10_680/C7A10_680 [Arabidopsis thaliana] AAN46757.1 At4g36680/C7A10_680 [Arabidopsis thaliana] AEE86686.1 Tetratricopeptide repeat (TPR)-like superfamily protein [Arabidopsis thaliana] OAO99432.1 hypothetical protein AXX17_AT4G41780 [Arabidopsis thaliana] Length = 412 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS 470 DAKGLIRT KKKFPPSFLN+W+K+EEE GL S Sbjct: 366 DAKGLIRTVKKKFPPSFLNAWKKLEEELGLYS 397 >XP_010446761.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial-like [Camelina sativa] Length = 415 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/42 (61%), Positives = 31/42 (73%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANSGDVQEAR 440 DAKGLIRT KKKFPPSF+N+W+K+EEE GL S A+ Sbjct: 370 DAKGLIRTVKKKFPPSFMNAWKKLEEELGLYSNTDASPSSAK 411 >CAA05629.1 membrane-associated salt-inducible protein like, partial [Arabidopsis thaliana] Length = 428 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS 470 DAKGLIRT KKKFPPSFLN+W+K+EEE GL S Sbjct: 382 DAKGLIRTVKKKFPPSFLNAWKKLEEELGLYS 413 >XP_006410778.1 hypothetical protein EUTSA_v10017741mg, partial [Eutrema salsugineum] ESQ52231.1 hypothetical protein EUTSA_v10017741mg, partial [Eutrema salsugineum] Length = 308 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/43 (67%), Positives = 33/43 (76%), Gaps = 3/43 (6%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS---ANSGDVQE 446 DA GLIRTAK +FPPSFL+ WEK+EEE GLVS A+S QE Sbjct: 263 DANGLIRTAKNEFPPSFLDEWEKLEEELGLVSKTDASSSSAQE 305 >XP_002866998.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] EFH43257.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 411 Score = 58.5 bits (140), Expect = 8e-07 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVS 470 DAKGLIRT KKKFPPSF+N+W+K+EEE GL S Sbjct: 366 DAKGLIRTVKKKFPPSFMNAWKKLEEELGLYS 397 >KDO79503.1 hypothetical protein CISIN_1g015673mg [Citrus sinensis] Length = 403 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/44 (63%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANS-GDVQEAR 440 K+AKG+IRT KKKFPP+ L +W+K+EEE GLV A + GD Q+AR Sbjct: 359 KEAKGVIRTIKKKFPPNVLRAWKKVEEELGLVPAPAVGDGQKAR 402 >XP_006425713.1 hypothetical protein CICLE_v10025762mg [Citrus clementina] XP_006466769.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Citrus sinensis] ESR38953.1 hypothetical protein CICLE_v10025762mg [Citrus clementina] Length = 403 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/44 (63%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -3 Query: 568 KDAKGLIRTAKKKFPPSFLNSWEKIEEEFGLVSANS-GDVQEAR 440 K+AKG+IRT KKKFPP+ L +W+K+EEE GLV A + GD Q+AR Sbjct: 359 KEAKGVIRTIKKKFPPNVLRAWKKVEEELGLVPAPAVGDGQKAR 402 >XP_009109332.1 PREDICTED: pentatricopeptide repeat-containing protein At4g36680, mitochondrial [Brassica rapa] Length = 407 Score = 58.2 bits (139), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 565 DAKGLIRTAKKKFPPSFLNSWEKIEEEFGL 476 DAKGLIRT KKKFPPSFLN+W+K+EEE GL Sbjct: 367 DAKGLIRTVKKKFPPSFLNAWKKLEEELGL 396