BLASTX nr result
ID: Panax25_contig00031430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00031430 (470 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK65358.1 uncharacterized protein A4U43_C07F36290 [Asparagus of... 70 2e-12 GAU33169.1 hypothetical protein TSUD_206280 [Trifolium subterran... 70 2e-11 XP_018844673.1 PREDICTED: protein bem46 [Juglans regia] 70 2e-11 XP_009387068.1 PREDICTED: protein bem46 isoform X2 [Musa acumina... 70 2e-11 XP_018677226.1 PREDICTED: protein bem46 isoform X1 [Musa acumina... 70 3e-11 XP_016514305.1 PREDICTED: protein bem46-like [Nicotiana tabacum] 70 3e-11 XP_016510724.1 PREDICTED: protein bem46-like [Nicotiana tabacum] 70 3e-11 XP_009621406.1 PREDICTED: protein bem46 [Nicotiana tomentosiformis] 70 3e-11 XP_004507977.1 PREDICTED: protein bem46 [Cicer arietinum] 69 5e-11 XP_019463637.1 PREDICTED: protein bem46-like isoform X3 [Lupinus... 69 6e-11 XP_019463636.1 PREDICTED: protein bem46-like isoform X2 [Lupinus... 69 6e-11 XP_015889299.1 PREDICTED: protein bem46 [Ziziphus jujuba] 69 6e-11 OMO91736.1 protein bem46-like protein [Corchorus olitorius] 69 8e-11 XP_019463635.1 PREDICTED: protein bem46-like isoform X1 [Lupinus... 69 9e-11 KYP57585.1 Protein bem46 [Cajanus cajan] 69 9e-11 KZM87606.1 hypothetical protein DCAR_031940 [Daucus carota subsp... 68 1e-10 AFK43874.1 unknown [Lotus japonicus] 68 1e-10 XP_009784315.1 PREDICTED: protein bem46 [Nicotiana sylvestris] 68 1e-10 KZM87607.1 hypothetical protein DCAR_024724 [Daucus carota subsp... 68 2e-10 XP_017218795.1 PREDICTED: protein bem46 [Daucus carota subsp. sa... 68 2e-10 >ONK65358.1 uncharacterized protein A4U43_C07F36290 [Asparagus officinalis] Length = 150 Score = 70.1 bits (170), Expect = 2e-12 Identities = 38/85 (44%), Positives = 53/85 (62%), Gaps = 2/85 (2%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHK--GNDLKAT*SSSELPV 296 FV+F +GMHMDTW+SGGDRYWRTIQLFLE+ EK++ L+HK GN+ Sbjct: 73 FVDFPSGMHMDTWLSGGDRYWRTIQLFLEQYASEKQEIKLSHKVDGNN------------ 120 Query: 295 ESCCHVLHLGYLGIQKMTSQHVNAL 221 E+ C + + +K+T + +AL Sbjct: 121 ETFCTLKKMNVSHSEKITKRQGSAL 145 >GAU33169.1 hypothetical protein TSUD_206280 [Trifolium subterraneum] Length = 352 Score = 70.5 bits (171), Expect = 2e-11 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKAT 320 FVEF GMHMDTW +GGD YWRTIQ FLE++ EKK+G + GND+ A+ Sbjct: 255 FVEFPTGMHMDTWQAGGDHYWRTIQQFLEQHAPEKKEGRSSQNGNDVGAS 304 >XP_018844673.1 PREDICTED: protein bem46 [Juglans regia] Length = 315 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKA 323 FV+F GMHMDTW++GGD YW+TIQ FLE++V EKK+ + GND +A Sbjct: 266 FVDFPTGMHMDTWVAGGDHYWKTIQQFLEEHVPEKKENESSRNGNDFEA 314 >XP_009387068.1 PREDICTED: protein bem46 isoform X2 [Musa acuminata subsp. malaccensis] Length = 320 Score = 70.1 bits (170), Expect = 2e-11 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLK 326 FVEF NGMHMDTW SGGDRYWRTIQLFL++ V E K+G L + +D K Sbjct: 267 FVEFPNGMHMDTWFSGGDRYWRTIQLFLDQYVPEIKEGNLNCQVDDDK 314 >XP_018677226.1 PREDICTED: protein bem46 isoform X1 [Musa acuminata subsp. malaccensis] Length = 334 Score = 70.1 bits (170), Expect = 3e-11 Identities = 33/48 (68%), Positives = 38/48 (79%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLK 326 FVEF NGMHMDTW SGGDRYWRTIQLFL++ V E K+G L + +D K Sbjct: 267 FVEFPNGMHMDTWFSGGDRYWRTIQLFLDQYVPEIKEGNLNCQVDDDK 314 >XP_016514305.1 PREDICTED: protein bem46-like [Nicotiana tabacum] Length = 325 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FVEF NGMHMDTW++GGD YWRTIQ FLE+ VR+KKD Sbjct: 267 FVEFPNGMHMDTWLAGGDHYWRTIQQFLEETVRKKKD 303 >XP_016510724.1 PREDICTED: protein bem46-like [Nicotiana tabacum] Length = 325 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FVEF NGMHMDTW++GGD YWRTIQ FLE+ VR+KKD Sbjct: 267 FVEFPNGMHMDTWLAGGDHYWRTIQQFLEETVRKKKD 303 >XP_009621406.1 PREDICTED: protein bem46 [Nicotiana tomentosiformis] Length = 325 Score = 69.7 bits (169), Expect = 3e-11 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FVEF NGMHMDTW++GGD YWRTIQ FLE+ VR+KKD Sbjct: 267 FVEFPNGMHMDTWLAGGDHYWRTIQQFLEETVRKKKD 303 >XP_004507977.1 PREDICTED: protein bem46 [Cicer arietinum] Length = 316 Score = 69.3 bits (168), Expect = 5e-11 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKA 323 FVEF GMHMDTW++GGD YWRTIQ FLE++ EKK+ + GND+ A Sbjct: 267 FVEFPTGMHMDTWLTGGDHYWRTIQQFLEQHAPEKKEDRSSQNGNDVGA 315 >XP_019463637.1 PREDICTED: protein bem46-like isoform X3 [Lupinus angustifolius] Length = 265 Score = 68.6 bits (166), Expect = 6e-11 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKA 323 FV+F GMHMDTW++GGD YWRTIQ FL+++V EKK+G GN +K+ Sbjct: 213 FVDFPTGMHMDTWLNGGDHYWRTIQQFLKQHVPEKKEGIPPQNGNAIKS 261 >XP_019463636.1 PREDICTED: protein bem46-like isoform X2 [Lupinus angustifolius] Length = 316 Score = 68.9 bits (167), Expect = 6e-11 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKA 323 FV+F GMHMDTW++GGD YWRTIQ FL+++V EKK+G GND A Sbjct: 267 FVDFPTGMHMDTWLNGGDHYWRTIQQFLKQHVPEKKEGIPPQNGNDTGA 315 >XP_015889299.1 PREDICTED: protein bem46 [Ziziphus jujuba] Length = 316 Score = 68.9 bits (167), Expect = 6e-11 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGND 332 FVEF NGMHMDTW++GGD YWRTIQ FLE++ EKK+ +H +D Sbjct: 267 FVEFPNGMHMDTWLAGGDHYWRTIQQFLEQHAPEKKEDESSHNDDD 312 >OMO91736.1 protein bem46-like protein [Corchorus olitorius] Length = 363 Score = 68.9 bits (167), Expect = 8e-11 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDL-KAT*SSSEL 302 FVEF NGMHMDTW+SGGD YWRTIQ F E++V EKK + G+ K T SSS L Sbjct: 296 FVEFPNGMHMDTWLSGGDHYWRTIQEFFEQHVPEKKQSGSSQNGHGWHKLTKSSSSL 352 >XP_019463635.1 PREDICTED: protein bem46-like isoform X1 [Lupinus angustifolius] Length = 319 Score = 68.6 bits (166), Expect = 9e-11 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKA 323 FV+F GMHMDTW++GGD YWRTIQ FL+++V EKK+G GN +K+ Sbjct: 267 FVDFPTGMHMDTWLNGGDHYWRTIQQFLKQHVPEKKEGIPPQNGNAIKS 315 >KYP57585.1 Protein bem46 [Cajanus cajan] Length = 417 Score = 68.9 bits (167), Expect = 9e-11 Identities = 35/77 (45%), Positives = 47/77 (61%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKAT*SSSELPVES 290 FVEF GMHMDTW++GGD YWRTIQ FLE++ E+K+ + GN + ++ S Sbjct: 267 FVEFPTGMHMDTWVAGGDHYWRTIQQFLEQHAPEQKEDSSSQNGN------GNDKIFFLS 320 Query: 289 CCHVLHLGYLGIQKMTS 239 C VL LG G++ S Sbjct: 321 LCCVLKLGDYGLRMWDS 337 >KZM87606.1 hypothetical protein DCAR_031940 [Daucus carota subsp. sativus] Length = 255 Score = 67.8 bits (164), Expect = 1e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FV+F NGMHMDTWISGGD YWRTIQ FLE+NV EK + Sbjct: 219 FVDFPNGMHMDTWISGGDHYWRTIQSFLEENVPEKDE 255 >AFK43874.1 unknown [Lotus japonicus] Length = 316 Score = 68.2 bits (165), Expect = 1e-10 Identities = 29/49 (59%), Positives = 38/49 (77%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKDG*LTHKGNDLKA 323 FVEF GMHMDTW++GGDRYW T++ FLE++V EKK+ + GND+ A Sbjct: 267 FVEFPTGMHMDTWMTGGDRYWSTVREFLEQHVPEKKEDGSSQNGNDIVA 315 >XP_009784315.1 PREDICTED: protein bem46 [Nicotiana sylvestris] Length = 325 Score = 68.2 bits (165), Expect = 1e-10 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FVEF NGMHMDTW++GGD YWRTIQ FLE+ VR+K+D Sbjct: 267 FVEFPNGMHMDTWLAGGDHYWRTIQQFLEETVRKKED 303 >KZM87607.1 hypothetical protein DCAR_024724 [Daucus carota subsp. sativus] Length = 303 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FV+F NGMHMDTWISGGD YWRTIQ FLE+NV EK + Sbjct: 267 FVDFPNGMHMDTWISGGDHYWRTIQSFLEENVPEKDE 303 >XP_017218795.1 PREDICTED: protein bem46 [Daucus carota subsp. sativus] XP_017218796.1 PREDICTED: protein bem46 [Daucus carota subsp. sativus] Length = 304 Score = 67.8 bits (164), Expect = 2e-10 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = -2 Query: 469 FVEFRNGMHMDTWISGGDRYWRTIQLFLEKNVREKKD 359 FV+F NGMHMDTWISGGD YWRTIQ FLE+NV EK + Sbjct: 268 FVDFPNGMHMDTWISGGDHYWRTIQSFLEENVPEKDE 304