BLASTX nr result
ID: Panax25_contig00030876
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00030876 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017215352.1 PREDICTED: probable inactive leucine-rich repeat ... 63 4e-09 AFC98464.1 leucine-rich repeat kinase-like protein [Atriplex can... 59 2e-07 KNA19949.1 hypothetical protein SOVF_056750 [Spinacia oleracea] 58 2e-07 XP_010248929.1 PREDICTED: probable inactive leucine-rich repeat ... 57 4e-07 XP_010250786.1 PREDICTED: probable inactive leucine-rich repeat ... 57 5e-07 KMS99194.1 hypothetical protein BVRB_2g047090 [Beta vulgaris sub... 57 7e-07 XP_015866834.1 PREDICTED: probable inactive leucine-rich repeat ... 57 7e-07 XP_010693311.1 PREDICTED: probable inactive leucine-rich repeat ... 57 7e-07 EEF50934.1 leucine-rich repeat protein, putative [Ricinus communis] 56 1e-06 XP_015578122.1 PREDICTED: probable inactive leucine-rich repeat ... 56 1e-06 XP_011098853.1 PREDICTED: probable inactive leucine-rich repeat ... 56 1e-06 XP_007211300.1 hypothetical protein PRUPE_ppa001911mg [Prunus pe... 56 1e-06 XP_004297555.1 PREDICTED: probable inactive leucine-rich repeat ... 56 1e-06 ONI08015.1 hypothetical protein PRUPE_5G153400 [Prunus persica] ... 56 1e-06 XP_008239443.1 PREDICTED: probable inactive leucine-rich repeat ... 56 1e-06 XP_020107119.1 probable inactive leucine-rich repeat receptor-li... 56 1e-06 XP_010930133.1 PREDICTED: probable inactive leucine-rich repeat ... 55 2e-06 BAF28117.1 Os11g0308800, partial [Oryza sativa Japonica Group] 52 2e-06 OMP05577.1 hypothetical protein COLO4_08742 [Corchorus olitorius] 55 3e-06 OMO73682.1 hypothetical protein CCACVL1_17179 [Corchorus capsula... 55 3e-06 >XP_017215352.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Daucus carota subsp. sativus] KZM89144.1 hypothetical protein DCAR_026219 [Daucus carota subsp. sativus] Length = 745 Score = 63.2 bits (152), Expect = 4e-09 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFETVQQ 99 NRPSFED+LWNLQYAAQIQA DGD RFET++Q Sbjct: 712 NRPSFEDILWNLQYAAQIQANADGDHRFETMEQ 744 >AFC98464.1 leucine-rich repeat kinase-like protein [Atriplex canescens] Length = 606 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 RPSFEDVLWNLQYAAQ+QAT DGDQ+F +V S Sbjct: 574 RPSFEDVLWNLQYAAQVQATADGDQKFGSVAYS 606 >KNA19949.1 hypothetical protein SOVF_056750 [Spinacia oleracea] Length = 766 Score = 58.2 bits (139), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 RPSFEDVLWNLQYAAQ+QAT DGDQRF + S Sbjct: 734 RPSFEDVLWNLQYAAQVQATADGDQRFASPTHS 766 >XP_010248929.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Nelumbo nucifera] Length = 768 Score = 57.4 bits (137), Expect = 4e-07 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 +RPSFEDVLWNLQYAAQ+QAT DGDQR + Q+ Sbjct: 735 SRPSFEDVLWNLQYAAQVQATADGDQRSDVALQT 768 >XP_010250786.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Nelumbo nucifera] Length = 775 Score = 57.0 bits (136), Expect = 5e-07 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 +RPSFEDVLWNLQYA+Q+QAT DGDQR + Q+ Sbjct: 736 SRPSFEDVLWNLQYASQVQATADGDQRSDATSQT 769 >KMS99194.1 hypothetical protein BVRB_2g047090 [Beta vulgaris subsp. vulgaris] Length = 756 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRF 84 RPSFEDVLWNLQYAAQ+QAT DGDQ+F Sbjct: 724 RPSFEDVLWNLQYAAQVQATADGDQKF 750 >XP_015866834.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ziziphus jujuba] Length = 765 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFE 87 +RPSFED+LWNLQYAAQ+QAT DGDQR E Sbjct: 734 SRPSFEDILWNLQYAAQVQATADGDQRTE 762 >XP_010693311.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Beta vulgaris subsp. vulgaris] Length = 769 Score = 56.6 bits (135), Expect = 7e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRF 84 RPSFEDVLWNLQYAAQ+QAT DGDQ+F Sbjct: 737 RPSFEDVLWNLQYAAQVQATADGDQKF 763 >EEF50934.1 leucine-rich repeat protein, putative [Ricinus communis] Length = 769 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 +RPSFEDVLWNLQYAAQ+QAT D DQ+ ++ QS Sbjct: 736 SRPSFEDVLWNLQYAAQVQATADADQKSDSTSQS 769 >XP_015578122.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ricinus communis] XP_015578160.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ricinus communis] Length = 770 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 +RPSFEDVLWNLQYAAQ+QAT D DQ+ ++ QS Sbjct: 737 SRPSFEDVLWNLQYAAQVQATADADQKSDSTSQS 770 >XP_011098853.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Sesamum indicum] Length = 777 Score = 56.2 bits (134), Expect = 1e-06 Identities = 24/33 (72%), Positives = 28/33 (84%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFETVQQ 99 NRPSFEDVLWNLQYAAQ+QAT + DQ+ ET + Sbjct: 741 NRPSFEDVLWNLQYAAQVQATAEADQKSETTSR 773 >XP_007211300.1 hypothetical protein PRUPE_ppa001911mg [Prunus persica] Length = 742 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFET 90 +RPSFED+LWNLQYA Q+QAT DGD+RF++ Sbjct: 708 SRPSFEDILWNLQYAVQVQATADGDRRFDS 737 >XP_004297555.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Fragaria vesca subsp. vesca] Length = 747 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFET 90 +RPSFED+LWNLQYA Q+QAT DGD R++T Sbjct: 714 SRPSFEDILWNLQYAVQVQATADGDNRYDT 743 >ONI08015.1 hypothetical protein PRUPE_5G153400 [Prunus persica] ONI08016.1 hypothetical protein PRUPE_5G153400 [Prunus persica] ONI08017.1 hypothetical protein PRUPE_5G153400 [Prunus persica] ONI08018.1 hypothetical protein PRUPE_5G153400 [Prunus persica] Length = 755 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFET 90 +RPSFED+LWNLQYA Q+QAT DGD+RF++ Sbjct: 721 SRPSFEDILWNLQYAVQVQATADGDRRFDS 750 >XP_008239443.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Prunus mume] XP_008239444.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Prunus mume] Length = 755 Score = 55.8 bits (133), Expect = 1e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFET 90 +RPSFED+LWNLQYA Q+QAT DGD+RF++ Sbjct: 721 SRPSFEDILWNLQYAVQVQATADGDRRFDS 750 >XP_020107119.1 probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ananas comosus] XP_020107120.1 probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ananas comosus] XP_020107121.1 probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ananas comosus] XP_020107122.1 probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ananas comosus] XP_020107123.1 probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Ananas comosus] Length = 776 Score = 55.8 bits (133), Expect = 1e-06 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 RPS E+VLWNLQYAAQIQ TTDGDQR E QS Sbjct: 744 RPSIEEVLWNLQYAAQIQQTTDGDQRSEVSSQS 776 >XP_010930133.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 [Elaeis guineensis] Length = 776 Score = 55.5 bits (132), Expect = 2e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 RPS EDVLWNLQYAAQ+QAT DGDQR + Q+ Sbjct: 744 RPSMEDVLWNLQYAAQVQATADGDQRSDVASQA 776 >BAF28117.1 Os11g0308800, partial [Oryza sativa Japonica Group] Length = 102 Score = 52.4 bits (124), Expect = 2e-06 Identities = 23/33 (69%), Positives = 27/33 (81%) Frame = +1 Query: 4 RPSFEDVLWNLQYAAQIQATTDGDQRFETVQQS 102 RPS E+VLWNLQYAAQ+QA +DGDQR E Q+ Sbjct: 69 RPSIEEVLWNLQYAAQVQAISDGDQRSEVSSQT 101 >OMP05577.1 hypothetical protein COLO4_08742 [Corchorus olitorius] Length = 763 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFET 90 +RPSFEDVLWNLQYAAQ+QAT D DQR E+ Sbjct: 732 SRPSFEDVLWNLQYAAQVQATADADQRSES 761 >OMO73682.1 hypothetical protein CCACVL1_17179 [Corchorus capsularis] Length = 763 Score = 55.1 bits (131), Expect = 3e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +1 Query: 1 NRPSFEDVLWNLQYAAQIQATTDGDQRFET 90 +RPSFEDVLWNLQYAAQ+QAT D DQR E+ Sbjct: 732 SRPSFEDVLWNLQYAAQVQATADADQRSES 761