BLASTX nr result
ID: Panax25_contig00030820
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00030820 (414 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM84571.1 hypothetical protein DCAR_028007 [Daucus carota subsp... 60 2e-09 KZM84573.1 hypothetical protein DCAR_028005 [Daucus carota subsp... 56 4e-08 XP_013457107.1 hypothetical protein MTR_4g090545 [Medicago trunc... 50 7e-06 >KZM84571.1 hypothetical protein DCAR_028007 [Daucus carota subsp. sativus] Length = 65 Score = 59.7 bits (143), Expect = 2e-09 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 115 RSFSKSYDVEGRRRPIPRRGQVKVGIVLGIAQSLASVFSPTARTK 249 RSFS RRR IPRRGQVK GIV+G+AQS+ASVFSP ARTK Sbjct: 14 RSFSND---NMRRRSIPRRGQVKAGIVIGLAQSVASVFSPNARTK 55 >KZM84573.1 hypothetical protein DCAR_028005 [Daucus carota subsp. sativus] Length = 61 Score = 56.2 bits (134), Expect = 4e-08 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +1 Query: 148 RRRPIPRRGQVKVGIVLGIAQSLASVFSPTARTK 249 RRR IP+RGQVK GIVLG+AQS+ASVFSP AR K Sbjct: 25 RRRSIPKRGQVKAGIVLGLAQSVASVFSPRARAK 58 >XP_013457107.1 hypothetical protein MTR_4g090545 [Medicago truncatula] KEH31138.1 hypothetical protein MTR_4g090545 [Medicago truncatula] Length = 60 Score = 50.4 bits (119), Expect = 7e-06 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = +1 Query: 106 GRCRSFSKSYDVEGRRRPIPRRGQVKVGIVLGIAQSLASVFS 231 G +S +S RRPIP+RGQVKVGIV+G+A S+AS+FS Sbjct: 8 GMMKSGRRSIPQRNSRRPIPKRGQVKVGIVVGLANSVASIFS 49