BLASTX nr result
ID: Panax25_contig00030290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00030290 (1262 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP13612.1 unnamed protein product [Coffea canephora] 59 7e-06 >CDP13612.1 unnamed protein product [Coffea canephora] Length = 568 Score = 59.3 bits (142), Expect = 7e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = +1 Query: 1021 MAALINSVSPTKNPSFEHARKGCGFSSQILHVHSFLLNKSFSTVLAS 1161 MA L+NSVSP K+PS EH+R GFSS++L HSF LN F +LAS Sbjct: 1 MAVLLNSVSPIKHPSSEHSRNSAGFSSKVLKFHSFSLNNGFPRLLAS 47