BLASTX nr result
ID: Panax25_contig00030150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00030150 (1150 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019151364.1 PREDICTED: eukaryotic translation initiation fact... 59 4e-06 XP_019158273.1 PREDICTED: eukaryotic translation initiation fact... 58 9e-06 >XP_019151364.1 PREDICTED: eukaryotic translation initiation factor 2 subunit alpha homolog [Ipomoea nil] Length = 344 Score = 59.3 bits (142), Expect = 4e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 118 NYDLIGQEQGISVLRTAIAACTEEIERHKGKLTVKLAPR 2 N + +EQGI+VL AIAACTEEIERHKGKLTVK APR Sbjct: 254 NTQTLDKEQGITVLNQAIAACTEEIERHKGKLTVKEAPR 292 >XP_019158273.1 PREDICTED: eukaryotic translation initiation factor 2 subunit alpha homolog [Ipomoea nil] Length = 344 Score = 58.2 bits (139), Expect = 9e-06 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 118 NYDLIGQEQGISVLRTAIAACTEEIERHKGKLTVKLAPR 2 N + +EQGI++L AIAACTEEIERHKGKLTVK APR Sbjct: 254 NTQTLDKEQGIAILDKAIAACTEEIERHKGKLTVKEAPR 292